PDB entry 2r27

View 2r27 on RCSB PDB site
Description: Constitutively zinc-deficient mutant of human superoxide dismutase (SOD), C6A, H80S, H83S, C111S
Class: oxidoreductase
Keywords: oxidoreductase, beta barrel, Cu ion, Amyotrophic lateral sclerosis, Antioxidant, Disease mutation, Metal-binding
Deposited on 2007-08-24, released 2007-12-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.184
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (Start-153)
      • engineered (6)
      • engineered (80)
      • engineered (83)
      • engineered (111)
    Domains in SCOPe 2.07: d2r27a_
  • Chain 'B':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (Start-153)
      • engineered (6)
      • engineered (80)
      • engineered (83)
      • engineered (111)
    Domains in SCOPe 2.07: d2r27b_
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2r27A (A:)
    matkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagcts
    agphfnplsrkhggpkdeersvgslgnvtadkdgvadvsiedsvislsgdhsiigrtlvv
    hekaddlgkggneestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r27A (A:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplrsvgslgnvtadkdgvadvsiedsvislsgdhsiigrtlvvhekaddlgkggn
    agsrlacgvigiaq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2r27B (B:)
    matkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagcts
    agphfnplsrkhggpkdeersvgslgnvtadkdgvadvsiedsvislsgdhsiigrtlvv
    hekaddlgkggneestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r27B (B:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplrsvgslgnvtadkdgvadvsiedsvislsgdhsiigrtlvvhekaddlgkggn
    agsrlacgvigiaq