PDB entry 2r1g

View 2r1g on RCSB PDB site
Description: Coordinates of the thermus thermophilus 30S components neighboring RbfA as obtained by fitting into the CRYO-EM map of A 30S-RBFA complex
Class: ribosomal protein/RNA
Keywords: 30S RIBOSOME MATURATION PROTEIN RbfA, COLD SHOCK RESPONSE PROTEIN RbfA, 30S-RbfA COMPLEX, RbfA BINDING SITE ON THE 30S, Ribonucleoprotein, Ribosomal protein, RNA-binding, rRNA-binding, tRNA-binding, Antibiotic resistance, RIBOSOMAL PROTEIN/RNA COMPLEX
Deposited on 2007-08-22, released 2008-03-18
The last revision prior to the SCOP 1.75 freeze date was dated 2008-03-18, with a file datestamp of 2008-03-14.
Experiment type: EM
Resolution: 12.5 Å
R-factor: N/A
AEROSPACI score: -0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 16s ribosomal RNA helix 1
  • Chain 'B':
    Compound: 16s ribosomal RNA helix 18
  • Chain 'C':
    Compound: 16s ribosomal RNA helix 27
  • Chain 'D':
    Compound: 16s ribosomal RNA helix 28
  • Chain 'E':
    Compound: 16s ribosomal RNA helix 44
  • Chain 'F':
    Compound: 16s ribosomal RNA helix 45
  • Chain 'G':
    Compound: 30S ribosomal protein S9
    Species: Thermus thermophilus
    Gene: rpsI, rps9
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2r1gg1
  • Chain 'H':
    Compound: 30S ribosomal protein S12
    Species: Thermus thermophilus
    Gene: rpsL, rps12
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2r1gh1
  • Chain 'I':
    Compound: 30S ribosomal protein S13
    Species: Thermus thermophilus
    Gene: rpsM, rps13
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2r1gi1
  • Chain 'X':
    Compound: 16s ribosomal RNA helix 44

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2r1gG (G:)
    eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda
    yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr
    apqyskr
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2r1gH (H:)
    ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
    evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
    pkea
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2r1gI (I:)
    ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve
    ntwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagkk
    kaprk
    

  • Chain 'X':
    No sequence available.