PDB entry 2r1g
View 2r1g on RCSB PDB site
Description: Coordinates of the thermus thermophilus 30S components neighboring RbfA as obtained by fitting into the CRYO-EM map of A 30S-RBFA complex
Class: ribosomal protein/RNA
Keywords: 30S RIBOSOME MATURATION PROTEIN RbfA, COLD SHOCK RESPONSE PROTEIN RbfA, 30S-RbfA COMPLEX, RbfA BINDING SITE ON THE 30S, Ribonucleoprotein, Ribosomal protein, RNA-binding, rRNA-binding, tRNA-binding, Antibiotic resistance, RIBOSOMAL PROTEIN-RNA COMPLEX
Deposited on
2007-08-22, released
2008-03-18
The last revision prior to the SCOPe 2.08 freeze date was dated
2019-12-18, with a file datestamp of
2019-12-13.
Experiment type: EM
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: 16s ribosomal RNA helix 1
Species: synthetic construct, synthetic [TaxId:32630]
- Chain 'B':
Compound: 16s ribosomal RNA helix 18
Species: synthetic construct, synthetic [TaxId:32630]
- Chain 'C':
Compound: 16s ribosomal RNA helix 27
Species: synthetic construct, synthetic [TaxId:32630]
- Chain 'D':
Compound: 16s ribosomal RNA helix 28
Species: synthetic construct, synthetic [TaxId:32630]
- Chain 'E':
Compound: 16s ribosomal RNA helix 44
Species: synthetic construct, synthetic [TaxId:32630]
- Chain 'F':
Compound: 16s ribosomal RNA helix 45
Species: synthetic construct, synthetic [TaxId:32630]
- Chain 'G':
Compound: 30S ribosomal protein S9
Species: Thermus thermophilus [TaxId:262724]
Gene: rpsI, rps9
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2r1gg1 - Chain 'H':
Compound: 30S ribosomal protein S12
Species: Thermus thermophilus [TaxId:262724]
Gene: rpsL, rps12
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2r1gh1 - Chain 'I':
Compound: 30S ribosomal protein S13
Species: Thermus thermophilus [TaxId:262724]
Gene: rpsM, rps13
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2r1gi1 - Chain 'X':
Compound: 16s ribosomal RNA helix 44
Species: synthetic construct, synthetic [TaxId:32630]
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
No sequence available.
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.
- Chain 'E':
No sequence available.
- Chain 'F':
No sequence available.
- Chain 'G':
Sequence; same for both SEQRES and ATOM records: (download)
>2r1gG (G:)
eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda
yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr
apqyskr
- Chain 'H':
Sequence; same for both SEQRES and ATOM records: (download)
>2r1gH (H:)
ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
pkea
- Chain 'I':
Sequence; same for both SEQRES and ATOM records: (download)
>2r1gI (I:)
ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve
ntwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagkk
kaprk
- Chain 'X':
No sequence available.