PDB entry 2r0z

View 2r0z on RCSB PDB site
Description: PFA1 FAB complexed with GripI peptide fragment
Class: immune system
Keywords: immunoglobulin; Alzheimer disease; amyloid, IMMUNE SYSTEM
Deposited on 2007-08-21, released 2007-10-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.204
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: IgG2a Fab fragment heavy chain, Fd portion
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2R0Z (0-222)
  • Chain 'L':
    Compound: IgG2a Fab fragment light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A2NHM3 (0-218)
      • conflict (26)
      • conflict (100)
      • conflict (104)
      • conflict (110)
      • modified residue (218)
    Domains in SCOPe 2.06: d2r0zl1, d2r0zl2
  • Chain 'Q':
    Compound: GripI peptide fragment
    Database cross-references and differences (RAF-indexed):
    • PDB 2R0Z (0-5)
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2r0zL (L:)
    dvlmtqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpltfgagtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'Q':
    No sequence available.