PDB entry 2r0w

View 2r0w on RCSB PDB site
Description: PFA2 FAB complexed with Abeta1-8
Class: immune system
Keywords: immunoglobulin; Alzheimer disease; amyloid, IMMUNE SYSTEM
Deposited on 2007-08-21, released 2007-10-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: IgG2a Fab fragment heavy chain, Fd portion
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2r0wh1
  • Chain 'L':
    Compound: IgG2a Fab fragment light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A2NHM3 (0-218)
      • conflict (26)
      • conflict (100)
      • conflict (104)
      • modified residue (218)
    Domains in SCOPe 2.07: d2r0wl1, d2r0wl2
  • Chain 'Q':
    Compound: Amyloid beta peptide fragment
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2r0wH (H:)
    qvtlkesgpgilkpsqtlsltcslsgfslrtsgmgvgwirqpsgkglewlahiwwdddkn
    ynpslksqltiskdtsrnqvflkitsvdtadtatyycvrrahnvvlgdwfaywgqgtlvt
    vsaakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavl
    qsdlytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r0wH (H:)
    qvtlkesgpgilkpsqtlsltcslsgfslrtsgmgvgwirqpsgkglewlahiwwdddkn
    ynpslksqltiskdtsrnqvflkitsvdtadtatyycvrrahnvvlgdwfaywgqgtlvt
    vsaakttapsvyplapvssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlyt
    lsssvtvtsstwpsqsitcnvahpasstkvdkkiepr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2r0wL (L:)
    dvlmtqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpltfgagtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'Q':
    No sequence available.