PDB entry 2r0o

View 2r0o on RCSB PDB site
Description: Crystal structure of the actin-binding domain of human alpha-actinin-4 mutant(K255E)
Class: Actin-binding protein
Keywords: CALPONIN HOMOLOGY DOMAIN, CH DOMAIN, STRUCTURAL PROTEIN, ACTIN-BINDING PROTEIN, ACTIN-CROSSLINKING, GLOMERULOSCLEROS SPECTRIN FAMILY, Disease mutation, Nucleus, Phosphorylation
Deposited on 2007-08-20, released 2008-02-05
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.174
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-actinin-4
    Species: Homo sapiens [TaxId:9606]
    Gene: ACTN4
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43707 (7-231)
      • expression tag (6)
      • engineered (215)
      • expression tag (232)
    Domains in SCOPe 2.05: d2r0oa1, d2r0oa2
  • Chain 'B':
    Compound: Alpha-actinin-4
    Species: Homo sapiens [TaxId:9606]
    Gene: ACTN4
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43707 (7-231)
      • expression tag (4-6)
      • engineered (215)
      • expression tag (232)
    Domains in SCOPe 2.05: d2r0ob1, d2r0ob2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2r0oA (A:)
    gamdpefawekqqrktftawcnshlrkagtqienidedfrdglklmlllevisgerlpkp
    ergkmrvhkinnvnkaldfiaskgvklvsigaeeivdgnakmtlgmiwtiilrfaiqdis
    veetsakeglllwcqrktapyknvnvqnfhiswkdglafnalihrhrpelieydklrkdd
    pvtnlnnafevaekyldipkmldaedivntarpdeeaimtyvssfyhafsgaldeln
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r0oA (A:)
    fawekqqrktftawcnshlrkagtqienidedfrdglklmlllevisgerlpkpergkmr
    vhkinnvnkaldfiaskgvklvsigaeeivdgnakmtlgmiwtiilrfaiqdisveetsa
    keglllwcqrktapyknvnvqnfhiswkdglafnalihrhrpelieydklrkddpvtnln
    nafevaekyldipkmldaedivntarpdeeaimtyvssfyhafsgal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2r0oB (B:)
    gamdpefawekqqrktftawcnshlrkagtqienidedfrdglklmlllevisgerlpkp
    ergkmrvhkinnvnkaldfiaskgvklvsigaeeivdgnakmtlgmiwtiilrfaiqdis
    veetsakeglllwcqrktapyknvnvqnfhiswkdglafnalihrhrpelieydklrkdd
    pvtnlnnafevaekyldipkmldaedivntarpdeeaimtyvssfyhafsgaldeln
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r0oB (B:)
    pefawekqqrktftawcnshlrkagtqienidedfrdglklmlllevisgerlpkpergk
    mrvhkinnvnkaldfiaskgvklvsigaeeivdgnakmtlgmiwtiilrfaiqdisveet
    sakeglllwcqrktapyknvnvqnfhiswkdglafnalihrhrpelieydklrkddpvtn
    lnnafevaekyldipkmldaedivntarpdeeaimtyvssfyhafsgal