PDB entry 2r0k

View 2r0k on RCSB PDB site
Description: Protease domain of HGFA with inhibitor Fab58
Class: hydrolase, immune system
Keywords: serine protease, antibody, inhibitor, EGF-like domain, Glycoprotein, Hydrolase, Kringle, Secreted, Zymogen, IMMUNE SYSTEM
Deposited on 2007-08-20, released 2007-12-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 3.51 Å
R-factor: 0.254
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatocyte growth factor activator
    Species: Homo sapiens [TaxId:9606]
    Gene: HGFAC
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: antibody heavy chain of Fab58, Fab portion only
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2R0K (0-End)
    Domains in SCOPe 2.06: d2r0kh1, d2r0kh2
  • Chain 'L':
    Compound: antibody light chain of Fab58
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2R0K (0-213)

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2r0kH (H:)
    evqlvesggglvqpggslrlscaasgftitgsaihwvrqapgkglewvaiinpnggytyy
    adsvkgrftisadtskntaylqmnslraedtavyycarsarfsfdywgqgtlvtvssast
    kgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly
    slssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdktht
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r0kH (H:)
    evqlvesggglvqpggslrlscaasgftitgsaihwvrqapgkglewvaiinpnggytyy
    adsvkgrftisadtskntaylqmnslraedtavyycarsarfsfdywgqgtlvtvssast
    kgpsvfplapgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvt
    vpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'L':
    No sequence available.