PDB entry 2qz6

View 2qz6 on RCSB PDB site
Description: First crystal structure of a psychrophile class C beta-lactamase
Class: hydrolase
Keywords: class C beta-lactamase, psychrophile, cold adaptation, Antibiotic resistance, Hydrolase, Periplasm
Deposited on 2007-08-16, released 2008-03-18
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: 0.192
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Pseudomonas fluorescens [TaxId:294]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2qz6a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qz6A (A:)
    atdirqvvdstveplmqqqdiaglsvaviqngkaqyfnygvankdskqpitentlfeigs
    vsktftatlagyalangklklsdpasqylpalrgdkfdhisllnlgtytagglplqfpee
    sdntgkmisyyqhwkpafapgtqrlysnpsiglfghlaaqslgqpfeklmeqtvlpklgl
    khtfisvpetqmslyaqgydkagkpvrvspgaldaeaygiktstsdlihyvevnmhpakl
    ekplqqaiaathtgyytvdgmtqglgwemypypikvdalvegnstqmamephkvnwltpp
    qaapldtlvnktgstggfgayvayvpskglgvvilanknypnaervkaahailsamdq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qz6A (A:)
    dirqvvdstveplmqqqdiaglsvaviqngkaqyfnygvankdskqpitentlfeigsvs
    ktftatlagyalangklklsdpasqylpalrgdkfdhisllnlgtytagglplqfptgkm
    isyyqhwkpafapgtqrlysnpsiglfghlaaqslgqpfeklmeqtvlpklglkhtfisv
    petqmslyaqgydkagkpvrvspgaldaeaygiktstsdlihyvevnmhpaklekplqqa
    iaathtgyytvdgmtqglgwemypypikvdalvegnstqmamephkvnwltppqaapldt
    lvnktgstggfgayvayvpskglgvvilanknypnaervkaahailsam