PDB entry 2qyo

View 2qyo on RCSB PDB site
Description: Crystal structure of isoflavone O-methyltransferase homolog in complex with biochanin A and SAH
Class: transferase
Keywords: isoflavone O-methyltransferase 3, surface binding site
Deposited on 2007-08-15, released 2008-08-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.214
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: O-methyltransferase
    Species: Medicago truncatula
    Gene: Medicago truncatula IOMT3 gene
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2qyoa1, d2qyoa2
  • Chain 'B':
    Compound: O-methyltransferase
    Species: Medicago truncatula
    Gene: Medicago truncatula IOMT3 gene
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2qyob1, d2qyob2
  • Heterogens: K, SAH, QSO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qyoA (A:)
    massinnrkpseifkaqallyknmyafvdsmslkwsiemnipniihnhgkpitlsnlvsi
    lqipstkvdnvqrlmrylahngffeiitnqeleneeeayaltvasellvkgtelclapmv
    ecvldptlstsfhnlkkwvyeedltlfavnlgcdlweflnknpeyntlyndalasdskmi
    nlamkdcnlvfeglesivdvgggngttgkiicetfpkltcvvfdrpkvvenlcgsnnlty
    vggdmfisvpkadavllkavlhdwtdkdcikilkkckeavtsdgkrgkvividmvinekk
    denqltqikllmnvtiscvngkerneeewkklfieagfqdykispftglmslieiyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qyoA (A:)
    innrkpseifkaqallyknmyafvdsmslkwsiemnipniihnhgkpitlsnlvsilqip
    stkvdnvqrlmrylahngffeiitnqeleneeeayaltvasellvkgtelclapmvecvl
    dptlstsfhnlkkwvyeedltlfavnlgcdlweflnknpeyntlyndalasdskminlam
    kdcnlvfeglesivdvgggngttgkiicetfpkltcvvfdrpkvvenlcgsnnltyvggd
    mfisvpkadavllkavlhdwtdkdcikilkkckeavtsdgkrgkvividmvinekkdenq
    ltqikllmnvtiscvngkerneeewkklfieagfqdykispftglmslieiyp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2qyoB (B:)
    massinnrkpseifkaqallyknmyafvdsmslkwsiemnipniihnhgkpitlsnlvsi
    lqipstkvdnvqrlmrylahngffeiitnqeleneeeayaltvasellvkgtelclapmv
    ecvldptlstsfhnlkkwvyeedltlfavnlgcdlweflnknpeyntlyndalasdskmi
    nlamkdcnlvfeglesivdvgggngttgkiicetfpkltcvvfdrpkvvenlcgsnnlty
    vggdmfisvpkadavllkavlhdwtdkdcikilkkckeavtsdgkrgkvividmvinekk
    denqltqikllmnvtiscvngkerneeewkklfieagfqdykispftglmslieiyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qyoB (B:)
    nnrkpseifkaqallyknmyafvdsmslkwsiemnipniihnhgkpitlsnlvsilqips
    tkvdnvqrlmrylahngffeiitnqeleneeeayaltvasellvkgtelclapmvecvld
    ptlstsfhnlkkwvyeedltlfavnlgcdlweflnknpeyntlyndalasdskminlamk
    dcnlvfeglesivdvgggngttgkiicetfpkltcvvfdrpkvvenlcgsnnltyvggdm
    fisvpkadavllkavlhdwtdkdcikilkkckeavtsdgkrgkvividmvinekkdenql
    tqikllmnvtiscvngkerneeewkklfieagfqdykispftglmslieiyp