PDB entry 2qy0

View 2qy0 on RCSB PDB site
Description: Active dimeric structure of the catalytic domain of C1r reveals enzyme-product like contacts
Class: hydrolase
Keywords: complement, serine protease, beta barrel, Complement pathway, EGF-like domain, Glycoprotein, Hydrolase, Hydroxylation, Immune response, Innate immunity, Phosphorylation, Polymorphism, Sushi
Deposited on 2007-08-13, released 2008-02-05
The last revision prior to the SCOP 1.75 freeze date was dated 2008-02-26, with a file datestamp of 2008-02-22.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.213
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Complement C1r subcomponent
    Species: HOMO SAPIENS
    Gene: C1R
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00736 (4-158)
      • expression tag (2-3)
  • Chain 'B':
    Compound: Complement C1r subcomponent
    Species: HOMO SAPIENS
    Gene: C1R
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2qy0b1
  • Chain 'C':
    Compound: Complement C1r subcomponent
    Species: HOMO SAPIENS
    Gene: C1R
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00736 (4-158)
      • expression tag (2-3)
  • Chain 'D':
    Compound: Complement C1r subcomponent
    Species: HOMO SAPIENS
    Gene: C1R
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2qy0d1
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2qy0B (B:)
    iiggqkakmgnfpwqvftnihgrgggallgdrwiltaahtlypkeheaqsnasldvflgh
    tnveelmklgnhpirrvsvhpdyrqdesynfegdiallelensvtlgpnllpiclpdndt
    fydlglmgyvsgfgvmeekiahdlrfvrlpvanpqacenwlrgknrmdvfsqnmfcaghp
    slkqdacqgdsggvfavrdpntdrwvatgivswgigcsrgygfytkvlnyvdwikkemee
    ed
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qy0B (B:)
    iiggqkakmgnfpwqvftnihgrgggallgdrwiltaahtlypkeheasldvflghtnve
    elmklgnhpirrvsvhpdyrqdesynfegdiallelensvtlgpnllpiclpdndtfydl
    glmgyvsgfgvmeekiahdlrfvrlpvanpqacenwlrgknrmdvfsqnmfcaghpslkq
    dacqgdsggvfavrdpntdrwvatgivswgigcsrgygfytkvlnyvdwikkemee
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2qy0D (D:)
    iiggqkakmgnfpwqvftnihgrgggallgdrwiltaahtlypkeheaqsnasldvflgh
    tnveelmklgnhpirrvsvhpdyrqdesynfegdiallelensvtlgpnllpiclpdndt
    fydlglmgyvsgfgvmeekiahdlrfvrlpvanpqacenwlrgknrmdvfsqnmfcaghp
    slkqdacqgdsggvfavrdpntdrwvatgivswgigcsrgygfytkvlnyvdwikkemee
    ed
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qy0D (D:)
    iiggqkakmgnfpwqvftnihgrgggallgdrwiltaahtlypkehsnasldvflghtnv
    eelmklgnhpirrvsvhpdyrqdesynfegdiallelensvtlgpnllpiclpdndtfyd
    lglmgyvsgfgvmeekiahdlrfvrlpvanpqacenwlrgknrmdvfsqnmfcaghpslk
    qdacqgdsggvfavrdpntdrwvatgivswgigcsrgygfytkvlnyvdwikkemee