PDB entry 2qxy

View 2qxy on RCSB PDB site
Description: Crystal structure of a response regulator from Thermotoga maritima
Class: transcription
Keywords: Response regulator, regulation of transcription, NYSGXRC, Protein Structure Initiative II (PSI II), 11013u, Structural Genomics, New York SGX Research Center for Structural Genomics
Deposited on 2007-08-13, released 2007-08-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.219
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Response regulator
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM_0842
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZU6 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.07: d2qxya1, d2qxya2
  • Chain 'B':
    Compound: Response regulator
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM_0842
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qxyb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qxyA (A:)
    msltptvmvvdesritflavknalekdgfnviwakneqeaftflrrekidlvfvdvfege
    eslnlirrireefpdtkvavlsayvdkdliinsvkagavdyilkpfrldyllervkkiis
    stprvtvslrknieeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qxyA (A:)
    ltptvmvvdesritflavknalekdgfnviwakneqeaftflrrekidlvfvdvfegees
    lnlirrireefpdtkvavlsayvdkdliinsvkagavdyilkpfrldyllervkkiiss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2qxyB (B:)
    msltptvmvvdesritflavknalekdgfnviwakneqeaftflrrekidlvfvdvfege
    eslnlirrireefpdtkvavlsayvdkdliinsvkagavdyilkpfrldyllervkkiis
    stprvtvslrknieeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qxyB (B:)
    tptvmvvdesritflavknalekdgfnviwakneqeaftflrrekidlvfvdvfegeesl
    nlirrireefpdtkvavlsayvdkdliinsvkagavdyilkpfrldyllervkkiis