PDB entry 2qxj

View 2qxj on RCSB PDB site
Description: Crystal Structure of Human Kallikrein 7 in Complex with Suc-Ala-Ala-Pro-Phe-chloromethylketone and Copper
Class: hydrolase
Keywords: copper, histidine ligands, catalytic triad HIS, Alternative splicing, Glycoprotein, Hydrolase, Protease, Secreted, Serine protease, Zymogen
Deposited on 2007-08-11, released 2008-01-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.214
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kallikrein-7
    Species: Homo sapiens [TaxId:9606]
    Gene: KLK7, PRSS6, SCCE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2qxja_
  • Heterogens: CU, K7J, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2qxjA (A:)
iidgapcargshpwqvallsgnqlhcggvlvnerwvltaahckmneytvhlgsdtlgdrr
aqrikasksfrhpgystqthvndlmlvklnsqarlssmvkkvrlpsrceppgttctvsgw
gtttspdvtfpsdlmcvdvklispqdctkvykdllensmlcagipdskknacngdsggpl
vcrgtlqglvswgtfpcgqpndpgvytqvckftkwindtmkkhr