PDB entry 2qws

View 2qws on RCSB PDB site
Description: Neutron and X-ray structural studies of short hydrogen bonds in Photoactive Yellow Protein (PYP)
Class: signaling protein
Keywords: neutron, hydrogen bond, photocycle, Chromophore, Photoreceptor protein, Receptor, Sensory transduction, SIGNALING PROTEIN
Deposited on 2007-08-10, released 2008-03-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-25, with a file datestamp of 2018-04-20.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Photoactive yellow protein
    Species: Halorhodospira halophila [TaxId:1053]
    Gene: PYP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2qwsa_
  • Heterogens: HC4, DOD

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2qwsA (A:)
mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaegditgrdpkqvigk
nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
fvkrv