PDB entry 2qtt

View 2qtt on RCSB PDB site
Description: Crystal Structure of Arabidopsis thaliana 5'-Methylthioadenosine nucleosidase in complex with Formycin A
Class: hydrolase
Keywords: nucleosidase, apo, rossmann fold, hydrolase
Deposited on 2007-08-02, released 2008-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-02-04, with a file datestamp of 2015-01-30.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.178
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-Methylthioadenosine Nucleosidase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AT4g38800
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qtta_
  • Chain 'B':
    Compound: 5'-Methylthioadenosine Nucleosidase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AT4g38800
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qttb_
  • Heterogens: ADE, EDO, FMC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qttA (A:)
    maphgdglsdieepevdaqseilrpissvvfviamqaealplvnkfglsettdsplgkgl
    pwvlyhgvhkdlrinvvcpgrdaalgidsvgtvpaslitfasiqalkpdiiinagtcggf
    kvkganigdvflvsdvvfhdrripipmfdlygvglrqafstpnllkelnlkigrlstgds
    ldmstqdetliiandatlkdmegaavayvadllkipvvflkavtdlvdgdkptaeeflqn
    ltvvtaalegtatkvinfingrnlsdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qttA (A:)
    seilrpissvvfviamqaealplvnkfglsettdsplgkglpwvlyhgvhkdlrinvvcp
    grdaalgidsvgtvpaslitfasiqalkpdiiinagtcggfkvkganigdvflvsdvvfh
    drripipmfdlygvglrqafstpnllkelnlkigrlstgdsldmstqdetliiandatlk
    dmegaavayvadllkipvvflkavtdlvdgdkptaeeflqnltvvtaalegtatkvinfi
    ngrnlsdl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2qttB (B:)
    maphgdglsdieepevdaqseilrpissvvfviamqaealplvnkfglsettdsplgkgl
    pwvlyhgvhkdlrinvvcpgrdaalgidsvgtvpaslitfasiqalkpdiiinagtcggf
    kvkganigdvflvsdvvfhdrripipmfdlygvglrqafstpnllkelnlkigrlstgds
    ldmstqdetliiandatlkdmegaavayvadllkipvvflkavtdlvdgdkptaeeflqn
    ltvvtaalegtatkvinfingrnlsdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qttB (B:)
    lrpissvvfviamqaealplvnkfglsettdsplgkglpwvlyhgvhkdlrinvvcpgrd
    aalgidsvgtvpaslitfasiqalkpdiiinagtcggfkvkganigdvflvsdvvfhdrr
    ipipmfdlygvglrqafstpnllkelnlkigrlstgdsldmstqdetliiandatlkdme
    gaavayvadllkipvvflkavtdlvdgdkptaeeflqnltvvtaalegtatkvinfingr
    nlsdl