PDB entry 2qtg

View 2qtg on RCSB PDB site
Description: Crystal Structure of Arabidopsis thaliana 5'-Methylthioadenosine nucleosidase in complex with 5'-methylthiotubercidin
Class: Hydrolase
Keywords: nucleosidase, apo, rossmann fold, Hydrolase
Deposited on 2007-08-02, released 2008-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.185
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-Methylthioadenosine Nucleosidase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AT4g38800
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qtga_
  • Chain 'B':
    Compound: 5'-Methylthioadenosine Nucleosidase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AT4g38800
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qtgb_
  • Heterogens: MTH, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qtgA (A:)
    maphgdglsdieepevdaqseilrpissvvfviamqaealplvnkfglsettdsplgkgl
    pwvlyhgvhkdlrinvvcpgrdaalgidsvgtvpaslitfasiqalkpdiiinagtcggf
    kvkganigdvflvsdvvfhdrripipmfdlygvglrqafstpnllkelnlkigrlstgds
    ldmstqdetliiandatlkdmegaavayvadllkipvvflkavtdlvdgdkptaeeflqn
    ltvvtaalegtatkvinfingrnlsdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qtgA (A:)
    ilrpissvvfviamqaealplvnkfglsettdsplgkglpwvlyhgvhkdlrinvvcpgr
    daalgidsvgtvpaslitfasiqalkpdiiinagtcggfkvkganigdvflvsdvvfhdr
    ripipmfdlygvglrqafstpnllkelnlkigrlstgdsldmstqdetliiandatlkdm
    egaavayvadllkipvvflkavtdlvdgdkptaeeflqnltvvtaalegtatkvinfing
    rnlsdl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2qtgB (B:)
    maphgdglsdieepevdaqseilrpissvvfviamqaealplvnkfglsettdsplgkgl
    pwvlyhgvhkdlrinvvcpgrdaalgidsvgtvpaslitfasiqalkpdiiinagtcggf
    kvkganigdvflvsdvvfhdrripipmfdlygvglrqafstpnllkelnlkigrlstgds
    ldmstqdetliiandatlkdmegaavayvadllkipvvflkavtdlvdgdkptaeeflqn
    ltvvtaalegtatkvinfingrnlsdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qtgB (B:)
    lrpissvvfviamqaealplvnkfglsettdsplgkglpwvlyhgvhkdlrinvvcpgrd
    aalgidsvgtvpaslitfasiqalkpdiiinagtcggfkvkganigdvflvsdvvfhdrr
    ipipmfdlygvglrqafstpnllkelnlkigrlstgdsldmstqdetliiandatlkdme
    gaavayvadllkipvvflkavtdlvdgdkptaeeflqnltvvtaalegtatkvinfingr
    nlsdl