PDB entry 2qtc

View 2qtc on RCSB PDB site
Description: E. coli Pyruvate dehydrogenase E1 component E401K mutant with phosphonolactylthiamin diphosphate
Class: oxidoreductase
Keywords: pyruvate dehydrogenase, thiamin diphosphate, Glycolysis, Magnesium, Metal-binding, Oxidoreductase, Thiamine pyrophosphate
Deposited on 2007-08-01, released 2007-08-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyruvate dehydrogenase E1 component
    Species: Escherichia coli [TaxId:562]
    Gene: aceE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qtca1, d2qtca2, d2qtca3
  • Chain 'B':
    Compound: Pyruvate dehydrogenase E1 component
    Species: Escherichia coli [TaxId:562]
    Gene: aceE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qtcb1, d2qtcb2, d2qtcb3
  • Heterogens: MG, TDK, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qtcA (A:)
    serfpndvdpietrdwlqaiesvireegveraqylidqllaearkggvnvaagtgisnyi
    ntipveeqpeypgnlelerrirsairwnaimtvlraskkdlelgghmasfqssatiydvc
    fnhffrarneqdggdlvyfqghispgvyaraflegrltqeqldnfrqevhgnglssyphp
    klmpefwqfptvsmglgpigaiyqakflkylehrglkdtskqtvyaflgdgemdepeskg
    aitiatrekldnlvfvincnlqrldgpvtgngkiinelegifegagwnvikvmwgsrwde
    llrkdtsgkliqlmnetvdgdyqtfkskdgayvrehffgkypetaalvadwtdeqiwaln
    rgghdpkkiyaafkkaqetkgkatvilahtikgygmgdaakgkniahqvkkmnmdgvrhi
    rdrfnvpvsdadieklpyitfpegseehtylhaqrqklhgylpsrqpnfteklelpslqd
    fgalleeqskeisttiafvralnvmlknksikdrlvpiiadeartfgmeglfrqigiysp
    ngqqytpqdreqvayykedekgqilqeginelgagcswlaaatsystnnlpmipfyiyys
    mfgfqrigdlcwaagdqqargfliggtsgrttlngeglqhedghshiqsltipncisydp
    ayayevavimhdglermygekqenvyyyittlnenyhmpampegaeegirkgiykletie
    gskgkvqllgsgsilrhvreaaeilakdygvgsdvysvtsftelardgqdcerwnmlhpl
    etprvpyiaqvmndapavastdymklfaeqvrtyvpaddyrvlgtdgfgrsdsrenlrhh
    fevdasyvvvaalgelakrgeidkkvvadaiakfnidadkvnprla
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qtcA (A:)
    isnyintipveeqpeypgnlelerrirsairwnaimtvlraskkdlelgghmasfqssat
    iydvcfnhffrarneqdggdlvyfqghispgvyaraflegrltqeqldnfrqevhgngls
    syphpklmpefwqfptvsmglgpigaiyqakflkylehrglkdtskqtvyaflgdgemde
    peskgaitiatrekldnlvfvincnlqrldgpvtgngkiinelegifegagwnvikvmwg
    srwdellrkdtsgkliqlmnetvdgdyqtfkskdgayvrehffgkypetaalvadwtdeq
    iwalnrgghdpkkiyaafkkaqetkgkatvilahtikgygmgdaamdgvrhirdrfnvpv
    sdadieklpyitfpegseehtylhaqrqklhgylpsrqpnfteklelpslqdfgalleeq
    skeisttiafvralnvmlknksikdrlvpiiadeartfgmeglfrqigiyspedekgqil
    qeginelgagcswlaaatsystnnlpmipfyiyysmfgfqrigdlcwaagdqqargflig
    gtsgrttlngeglqhedghshiqsltipncisydpayayevavimhdglermygekqenv
    yyyittlnenyhmpampegaeegirkgiykletiegskgkvqllgsgsilrhvreaaeil
    akdygvgsdvysvtsftelardgqdcerwnmlhpletprvpyiaqvmndapavastdymk
    lfaeqvrtyvpaddyrvlgtdgfgrsdsrenlrhhfevdasyvvvaalgelakrgeidkk
    vvadaiakfnidadkvnprla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2qtcB (B:)
    serfpndvdpietrdwlqaiesvireegveraqylidqllaearkggvnvaagtgisnyi
    ntipveeqpeypgnlelerrirsairwnaimtvlraskkdlelgghmasfqssatiydvc
    fnhffrarneqdggdlvyfqghispgvyaraflegrltqeqldnfrqevhgnglssyphp
    klmpefwqfptvsmglgpigaiyqakflkylehrglkdtskqtvyaflgdgemdepeskg
    aitiatrekldnlvfvincnlqrldgpvtgngkiinelegifegagwnvikvmwgsrwde
    llrkdtsgkliqlmnetvdgdyqtfkskdgayvrehffgkypetaalvadwtdeqiwaln
    rgghdpkkiyaafkkaqetkgkatvilahtikgygmgdaakgkniahqvkkmnmdgvrhi
    rdrfnvpvsdadieklpyitfpegseehtylhaqrqklhgylpsrqpnfteklelpslqd
    fgalleeqskeisttiafvralnvmlknksikdrlvpiiadeartfgmeglfrqigiysp
    ngqqytpqdreqvayykedekgqilqeginelgagcswlaaatsystnnlpmipfyiyys
    mfgfqrigdlcwaagdqqargfliggtsgrttlngeglqhedghshiqsltipncisydp
    ayayevavimhdglermygekqenvyyyittlnenyhmpampegaeegirkgiykletie
    gskgkvqllgsgsilrhvreaaeilakdygvgsdvysvtsftelardgqdcerwnmlhpl
    etprvpyiaqvmndapavastdymklfaeqvrtyvpaddyrvlgtdgfgrsdsrenlrhh
    fevdasyvvvaalgelakrgeidkkvvadaiakfnidadkvnprla
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qtcB (B:)
    isnyintipveeqpeypgnlelerrirsairwnaimtvlraskkdlelgghmasfqssat
    iydvcfnhffrarneqdggdlvyfqghispgvyaraflegrltqeqldnfrqevhgngls
    syphpklmpefwqfptvsmglgpigaiyqakflkylehrglkdtskqtvyaflgdgemde
    peskgaitiatrekldnlvfvincnlqrldgpvtgngkiinelegifegagwnvikvmwg
    srwdellrkdtsgkliqlmnetvdgdyqtfkskdgayvrehffgkypetaalvadwtdeq
    iwalnrgghdpkkiyaafkkaqetkgkatvilahtikgygmgdaamdgvrhirdrfnvpv
    sdadieklpyitfpegseehtylhaqrqklhgylpsrqpnfteklelpslqdfgalleeq
    skeisttiafvralnvmlknksikdrlvpiiadeartfgmeglfrqigiyspedekgqil
    qeginelgagcswlaaatsystnnlpmipfyiyysmfgfqrigdlcwaagdqqargflig
    gtsgrttlngeglqhedghshiqsltipncisydpayayevavimhdglermygekqenv
    yyyittlnenyhmpampegaeegirkgiykletiegskgkvqllgsgsilrhvreaaeil
    akdygvgsdvysvtsftelardgqdcerwnmlhpletprvpyiaqvmndapavastdymk
    lfaeqvrtyvpaddyrvlgtdgfgrsdsrenlrhhfevdasyvvvaalgelakrgeidkk
    vvadaiakfnidadkvnprla