PDB entry 2qtb

View 2qtb on RCSB PDB site
Description: Human dipeptidyl peptidase iv/cd26 in complex with a 4-aryl cyclohexylalanine inhibitor
Class: hydrolase
Keywords: ALPHA/BETA, BETA-PROPELLER, DIMER, Aminopeptidase, Glycoprotein, Hydrolase, Membrane, Protease, Secreted, Serine protease, Signal-anchor, Transmembrane
Deposited on 2007-08-01, released 2007-11-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.187
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dipeptidyl peptidase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: DPP4, ADCP2, CD26
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27487 (Start-765)
      • engineered (38)
    Domains in SCOPe 2.06: d2qtba1, d2qtba2
  • Chain 'B':
    Compound: dipeptidyl peptidase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: DPP4, ADCP2, CD26
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27487 (Start-765)
      • engineered (38)
    Domains in SCOPe 2.06: d2qtbb1, d2qtbb2
  • Heterogens: NAG, NA, 474, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qtbA (A:)
    mktpwkvllgllgaaalvtiitvpvvllnkgtddatadtrktytltdylkntyrlklysl
    rwisdheylykqennilvfnaeygnssvflenstfdefghsindysispdgqfilleyny
    vkqwrhsytasydiydlnkrqliteeripnntqwvtwspvghklayvwnndiyvkiepnl
    psyritwtgkediiyngitdwvyeeevfsaysalwwspngtflayaqfndtevplieysf
    ysdeslqypktvrvpypkagavnptvkffvvntdslssvtnatsiqitapasmligdhyl
    cdvtwatqerislqwlrriqnysvmdicdydessgrwnclvarqhiemsttgwvgrfrps
    ephftldgnsfykiisneegyrhicyfqidkkdctfitkgtwevigiealtsdylyyisn
    eykgmpggrnlykiqlsdytkvtclscelnpercqyysvsfskeakyyqlrcsgpglply
    tlhssvndkglrvlednsaldkmlqnvqmpskkldfiilnetkfwyqmilpphfdkskky
    pllldvyagpcsqkadtvfrlnwatylasteniivasfdgrgsgyqgdkimhainrrlgt
    fevedqieaarqfskmgfvdnkriaiwgwsyggyvtsmvlgsgsgvfkcgiavapvsrwe
    yydsvyterymglptpednldhyrnstvmsraenfkqveyllihgtaddnvhfqqsaqis
    kalvdvgvdfqamwytdedhgiasstahqhiythmshfikqcfslp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qtbA (A:)
    trktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdef
    ghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtws
    pvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwsp
    ngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslss
    vtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwn
    clvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfit
    kgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyys
    vsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfii
    lnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivasf
    dgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvtsm
    vlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkqv
    eyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmshf
    ikqcfslp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2qtbB (B:)
    mktpwkvllgllgaaalvtiitvpvvllnkgtddatadtrktytltdylkntyrlklysl
    rwisdheylykqennilvfnaeygnssvflenstfdefghsindysispdgqfilleyny
    vkqwrhsytasydiydlnkrqliteeripnntqwvtwspvghklayvwnndiyvkiepnl
    psyritwtgkediiyngitdwvyeeevfsaysalwwspngtflayaqfndtevplieysf
    ysdeslqypktvrvpypkagavnptvkffvvntdslssvtnatsiqitapasmligdhyl
    cdvtwatqerislqwlrriqnysvmdicdydessgrwnclvarqhiemsttgwvgrfrps
    ephftldgnsfykiisneegyrhicyfqidkkdctfitkgtwevigiealtsdylyyisn
    eykgmpggrnlykiqlsdytkvtclscelnpercqyysvsfskeakyyqlrcsgpglply
    tlhssvndkglrvlednsaldkmlqnvqmpskkldfiilnetkfwyqmilpphfdkskky
    pllldvyagpcsqkadtvfrlnwatylasteniivasfdgrgsgyqgdkimhainrrlgt
    fevedqieaarqfskmgfvdnkriaiwgwsyggyvtsmvlgsgsgvfkcgiavapvsrwe
    yydsvyterymglptpednldhyrnstvmsraenfkqveyllihgtaddnvhfqqsaqis
    kalvdvgvdfqamwytdedhgiasstahqhiythmshfikqcfslp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qtbB (B:)
    trktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdef
    ghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtws
    pvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwsp
    ngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslss
    vtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwn
    clvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfit
    kgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyys
    vsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfii
    lnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivasf
    dgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvtsm
    vlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkqv
    eyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmshf
    ikqcfslp