PDB entry 2qsj

View 2qsj on RCSB PDB site
Description: Crystal structure of a LuxR family DNA-binding response regulator from Silicibacter pomeroyi
Class: transcription
Keywords: STRUCTURAL GENOMICS, DNA BINDING, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, DNA-binding, Transcription, Transcription regulation
Deposited on 2007-07-31, released 2007-08-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.23
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-binding response regulator, LuxR family
    Species: Silicibacter pomeroyi [TaxId:246200]
    Gene: SPO2369
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5LQW4 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.06: d2qsja1, d2qsja2
  • Chain 'B':
    Compound: DNA-binding response regulator, LuxR family
    Species: Silicibacter pomeroyi [TaxId:246200]
    Gene: SPO2369
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5LQW4 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.06: d2qsjb1, d2qsjb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qsjA (A:)
    msltvvlivddhhliragaknllegafsgmrvegaetvsdalafleadntvdlilldvnl
    pdaeaidglvrlkrfdpsnavalisgetdheliraaleagadgfipksadpqvlihavsl
    ilegeiflprsylqggrmaevatpldeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qsjA (A:)
    ltvvlivddhhliragaknllegafsgmrvegaetvsdalafleadntvdlilldvaidg
    lvrlkrfdpsnavaliheliraaleagadgfipksadpqvlihavslilegeiflprsyl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2qsjB (B:)
    msltvvlivddhhliragaknllegafsgmrvegaetvsdalafleadntvdlilldvnl
    pdaeaidglvrlkrfdpsnavalisgetdheliraaleagadgfipksadpqvlihavsl
    ilegeiflprsylqggrmaevatpldeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qsjB (B:)
    ltvvlivddhhliragaknllegafsgmrvegaetvsdalafleadntvdlilldvaidg
    lvrlkrfdpsnavalisgeheliraaleagadgfipksadpqvlihavslilegeiflpr
    sy