PDB entry 2qsc

View 2qsc on RCSB PDB site
Description: Crystal structure analysis of anti-HIV-1 V3-Fab F425-B4e8 in complex with a V3-peptide
Class: immune system
Keywords: Fab-peptide complex, HIV-1, gp120, V3 loop, immunoglobulin fold, AIDS, Apoptosis, Envelope protein, Fusion protein, Glycoprotein, Host-virus interaction, Membrane, Transmembrane, Viral immunoevasion, Virion, immune system
Deposited on 2007-07-30, released 2008-01-15
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.222
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab F425-B4e8, Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2QSC (0-221)
  • Chain 'L':
    Compound: Fab F425-B4e8, Light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2QSC (0-214)
    Domains in SCOPe 2.03: d2qscl1, d2qscl2
  • Chain 'P':
    Compound: envelope glycoprotein gp120
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, CL, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2qscL (L:)
nsvltqspsslsasvgdrvtitcqasqdisnylnwyqhkpgkapklliytasnletgvps
rfsgggsgthfsftitslqpedaatyfcqqydnlgdlsfgggtkveikrtvaapsvfifp
psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
tlskadyekhkvyacevthqglsspvtksfnrgec

  • Chain 'P':
    No sequence available.