PDB entry 2qr3

View 2qr3 on RCSB PDB site
Description: Crystal structure of the N-terminal signal receiver domain of two-component system response regulator from Bacteroides fragilis
Class: transcription
Keywords: STRUCTURAL GENOMICS, SIGNAL RECEIVER, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, ATP-binding, DNA-binding, Nucleotide-binding, Transcription, Transcription regulation, SIGNALING PROTEIN
Deposited on 2007-07-27, released 2007-08-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.204
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Two-component system response regulator
    Species: Bacteroides fragilis [TaxId:295405]
    Gene: BF2150
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q64UD2 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.06: d2qr3a1, d2qr3a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qr3A (A:)
    mslgtiiivddnkgvltavqlllknhfskvitlsspvslstvlreenpevvlldmnftsg
    inngneglfwlheikrqyrdlpvvlftayadidlavrgikegasdfvvkpwdnqklletl
    lnaasqakdgkkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qr3A (A:)
    slgtiiivddnkgvltavqlllknhfskvitlsspvslstvlreenpevvlldmnftsne
    glfwlheikrqyrdlpvvlftayadidlavrgikegasdfvvkpwdnqklletllnaasq
    a