PDB entry 2qqm

View 2qqm on RCSB PDB site
Description: Crystal Structure of the a2b1b2 Domains from Human Neuropilin-1
Class: signaling protein
Keywords: VEGF receptor, semaphorin receptor, calcium-binding domain, Angiogenesis, Developmental protein, Differentiation, Glycoprotein, Heparan sulfate, Membrane, Neurogenesis, Proteoglycan, Secreted, Transmembrane, HORMONE, SIGNALING PROTEIN
Deposited on 2007-07-26, released 2007-11-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.186
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuropilin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: NRP1, NRP, VEGF165R
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2qqma1, d2qqma2, d2qqma3
  • Heterogens: CA, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qqmA (A:)
    gshmfkrgpecsqnyttpsgvikspgfpekypnslectyivfapkmseiilefesfdlep
    dsnppggmfcrydrleiwdgfpdvgphigrycgqktpgrirsssgilsmvfytdsaiake
    gfsanysvlqssvsedfkcmealgmesgeihsdqitassqystnwsaersrlnypengwt
    pgedsyrewiqvdlgllrfvtavgtqgaisketkkkyyvktykidvssngedwitikegn
    kpvlfqgntnptdvvvavfpkplitrfvrikpatwetgismrfevygckitdypcsgmlg
    mvsglisdsqitssnqgdrnwmpenirlvtsrsgwalppaphsyinewlqidlgeekivr
    giiiqggkhrenkvfmrkfkigysnngsdwkmimddskrkaksfegnnnydtpelrtfpa
    lstrfiriyperathgglglrmellgceve
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qqmA (A:)
    pecsqnyttpsgvikspgfpekypnslectyivfapkmseiilefesfdlepdggmfcry
    drleiwdgfpdvgphigrycgqktpgrirsssgilsmvfytdsaiakegfsanysvlqss
    vsfkcmealgmesgeihsdqitassqystnwsaersrlnypengwtpgedsyrewiqvdl
    gllrfvtavgtqgaisketkkkyyvktykidvssngedwitikegnkpvlfqgntnptdv
    vvavfpkplitrfvrikpatwetgismrfevygckitdypcsgmlgmvsglisdsqitss
    nqgdrnwmpenirlvtsrsgwalppaphsyinewlqidlgeekivrgiiiqggkhrenkv
    fmrkfkigysnngsdwkmimddskrkaksfegnnnydtpelrtfpalstrfiriyperat
    hgglglrmellgceve