PDB entry 2qqj

View 2qqj on RCSB PDB site
Description: Crystal Structure of the b1b2 Domains from Human Neuropilin-2
Class: signaling protein
Keywords: VEGF receptor, semaphorin receptor, Developmental protein, Differentiation, Glycoprotein, Membrane, Neurogenesis, Transmembrane, HORMONE, SIGNALING PROTEIN
Deposited on 2007-07-26, released 2007-11-20
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.176
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuropilin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: NRP2, VEGF165R2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2qqja1, d2qqja2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qqjA (A:)
    gshmfqcnvplgmesgrianeqisasstysdgrwtpqqsrlhgddngwtpnldsnkeylq
    vdlrfltmltaiatqgaisretqngyyvksyklevstngedwmvyrhgknhkvfqannda
    tevvlnklhaplltrfvrirpqtwhsgialrlelfgcrvtdapcsnmlgmlsgliadsqi
    sasstqeylwspsaarlvssrsgwfpripqaqpgeewlqvdlgtpktvkgviiqgarggd
    sitavearafvrkfkvsyslngkdweyiqdprtqqpklfegnmhydtpdirrfdpipaqy
    vrvyperwspagigmrlevlgcdwt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qqjA (A:)
    qcnvplgmesgrianeqisasstysdgrwtpqqsrlhgddngwtpnldsnkeylqvdlrf
    ltmltaiatqgaisretqngyyvksyklevstngedwmvyrhgknhkvfqanndatevvl
    nklhaplltrfvrirpqtwhsgialrlelfgcrvtdapcsnmlgmlsgliadsqisasst
    qelwspsaarlvssrsgwfpripqaqpgeewlqvdlgtpktvkgviiqgarggavearaf
    vrkfkvsyslngkdweyiqdprtqqpklfegnmhydtpdirrfdpipaqyvrvyperwsp
    agigmrlevlgcdwt