PDB entry 2qq7

View 2qq7 on RCSB PDB site
Description: Crystal structure of drug resistant SRC kinase domain with irreversible inhibitor
Class: transferase
Keywords: Src kinase domain, drug resistance, irreversible inhibitor, Alternative splicing, ATP-binding, Lipoprotein, Myristate, Nucleotide-binding, Phosphorylation, Proto-oncogene, SH2 domain, SH3 domain, Transferase, Tyrosine-protein kinase
Deposited on 2007-07-26, released 2008-03-11
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: 0.217
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00523 (Start-285)
      • engineered (90)
      • engineered (97)
    Domains in SCOPe 2.03: d2qq7a_
  • Chain 'B':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00523 (Start-285)
      • engineered (90)
      • engineered (97)
    Domains in SCOPe 2.03: d2qq7b_
  • Heterogens: SR2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qq7A (A:)
    ghmqtqglakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaf
    lqeaqvmkklrheklvqlyavvseepiyivmeymskgclldflkgemgkylrlpqlvdma
    aqiasgmayvermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpik
    wtapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppec
    peslhdlmcqcwrkdpeerptfeylqafledyftstepqyqpgenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qq7A (A:)
    kdaweipreslrlevklgqgfgevwmgtwngttrvaiktlqeaqvmkklrheklvqlyav
    vseepiyivmeymskgclldflkgemgkylrlpqlvdmaaqiasgmayvermnyvhrdlr
    aanilvgenlvckvadfglarlpikwtapeaalygrftiksdvwsfgilltelttkgrvp
    ypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkdpeerptfeylqafledyfts
    tepqyqpgenl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2qq7B (B:)
    ghmqtqglakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaf
    lqeaqvmkklrheklvqlyavvseepiyivmeymskgclldflkgemgkylrlpqlvdma
    aqiasgmayvermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpik
    wtapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppec
    peslhdlmcqcwrkdpeerptfeylqafledyftstepqyqpgenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qq7B (B:)
    daweipreslrlevklgqggevwmgtwngttrvaiktlkqvmkklrheklvqlyavvsee
    piyivmeymskgclldflkgemgkylrlpqlvdmaaqiasgmayvermnyvhrdlraani
    lvgenlvckvadfglpikwtapeaalygrftiksdvwsfgilltelttkgrvpypgmvnr
    evldqvergyrmpcppecpeslhdlmcqcwrkdpeerptfeylqafledyftstepqyqp
    genl