PDB entry 2qpz

View 2qpz on RCSB PDB site
Description: Naphthalene 1,2-dioxygenase Rieske ferredoxin
Class: metal binding protein
Keywords: Rieske ferredoxin, 2Fe-2S, Aromatic hydrocarbons catabolism, Electron transport, Iron, Iron-sulfur, Metal-binding, Plasmid, Transport, METAL BINDING PROTEIN
Deposited on 2007-07-25, released 2008-09-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.157
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Naphthalene 1,2-dioxygenase system ferredoxin subunit
    Species: Pseudomonas putida [TaxId:303]
    Gene: ndoA, nahAB, ndoC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2qpza_
  • Heterogens: FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qpzA (A:)
    tvkwieavalsdilegdvlgvtvegkelalyevegeiyatdnlcthgsarmsdgylegre
    iecplhqgrfdvctgkalcapvtqniktypvkienlrvmidls