PDB entry 2qpe

View 2qpe on RCSB PDB site
Description: An unexpected outcome of surface-engineering an integral membrane protein: Improved crystallization of cytochrome ba3 oxidase from Thermus thermophilus
Class: Oxidoreductase
Keywords: cytochrome ba3 oxidase, heme,integral membrane protein, Electron transport, Hydrogen ion transport, Ion transport, Iron, Metal-binding, Oxidoreductase, Respiratory chain, Transmembrane, Transport, Formylation
Deposited on 2007-07-23, released 2007-12-11
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.237
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c oxidase subunit 1
    Species: Thermus thermophilus [TaxId:300852]
    Gene: cbaA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SJ79 (Start-567)
      • engineered (263)
    Domains in SCOPe 2.01: d2qpea_
  • Chain 'B':
    Compound: Cytochrome c oxidase subunit 2
    Species: Thermus thermophilus [TaxId:300852]
    Gene: cbaB, ctaC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SJ80 (Start-167)
      • engineered (3)
    Domains in SCOPe 2.01: d2qpeb1, d2qpeb2
  • Chain 'C':
    Compound: Cytochrome c oxidase polypeptide 2A
    Species: Thermus thermophilus [TaxId:300852]
    Gene: cbaD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2qpec1
  • Heterogens: CU1, HEM, HAS, CUA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qpeA (A:)
    mhhhhhhavraseisrvyeaypekkatlyflvlgflalivgslfgpfqalnygnvdaypl
    lkrllpfvqsyyqgltlhgvlnaivftqlfaqaimvylparelnmrpnmglmwlswwmaf
    iglvvaalpllaneatvlytfypplkghwafylgasvfvlstwvsiyivldlwrrwkaan
    pgkvtplvtymavvfwlmwflaslglvleavlfllpwsfglvegvdplvartlfwwtghp
    ivyfwllpayaiiytilpkqaggrlvsdpmarlafllflllstpvgfhhqfadpgidptw
    kmihsvltlfvavpslmtaftvaaslefagrlrggrglfgwiralpwdnpafvapvlgll
    gfipggaggivnasftldyvvhntawvpghfhlqvaslvtltamgslywllpnltgkpis
    daqrrlglavvwlwflgmmimavglhwagllnvprrayiaqvpdayphaavpmvfnvlag
    ivllvalllfiyglfsvllsrerkpelaeaplpfaevisgpedrrlvlamdrigfwfava
    ailvvlaygptlvqlfghlnpvpgwrlw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qpeA (A:)
    seisrvyeaypekkatlyflvlgflalivgslfgpfqalnygnvdaypllkrllpfvqsy
    yqgltlhgvlnaivftqlfaqaimvylparelnmrpnmglmwlswwmafiglvvaalpll
    aneatvlytfypplkghwafylgasvfvlstwvsiyivldlwrrwkaanpgkvtplvtym
    avvfwlmwflaslglvleavlfllpwsfglvegvdplvartlfwwtghpivyfwllpaya
    iiytilpkqaggrlvsdpmarlafllflllstpvgfhhqfadpgidptwkmihsvltlfv
    avpslmtaftvaaslefagrlrggrglfgwiralpwdnpafvapvlgllgfipggaggiv
    nasftldyvvhntawvpghfhlqvaslvtltamgslywllpnltgkpisdaqrrlglavv
    wlwflgmmimavglhwagllnvprrayiaqvpdayphaavpmvfnvlagivllvalllfi
    yglfsvllsrerkpelaeaplpfaevisgpedrrlvlamdrigfwfavaailvvlaygpt
    lvqlfghlnpvpgwrlw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2qpeB (B:)
    mvdqhkahkailayekgwlafslamlfvfialiaytlathtagvipagklervdpttvrq
    egpwadpaqavvqtgpnqytvyvlafafgyqpnpievpqgaeivfkitspdvihgfhveg
    tninvevlpgevstvrytfkrpgeyriicnqycglghqnmfgtivvke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qpeB (B:)
    dqhkahkailayekgwlafslamlfvfialiaytlathtagvipagklervdpttvrqeg
    pwadpaqavvqtgpnqytvyvlafafgyqpnpievpqgaeivfkitspdvihgfhvegtn
    invevlpgevstvrytfkrpgeyriicnqycglghqnmfgtivvke
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2qpeC (C:)
    meekpkgalavilvltltilvfwlgvyavffarg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qpeC (C:)
    eekpkgalavilvltltilvfwlgvyavffarg