PDB entry 2qpd

View 2qpd on RCSB PDB site
Description: An unexpected outcome of surface-engineering an integral membrane protein: Improved crystallization of cytochrome ba3 oxidase from Thermus thermophilus
Class: oxidoreductase
Keywords: cytochrome ba3 oxidase, heme,integral membrane protein, Electron transport, Hydrogen ion transport, Ion transport, Iron, Metal-binding, Oxidoreductase, Respiratory chain, Transmembrane, Transport, Formylation
Deposited on 2007-07-23, released 2007-12-11
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.25 Å
R-factor: 0.22
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c oxidase subunit 1
    Species: Thermus thermophilus [TaxId:300852]
    Gene: cbaA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SJ79 (Start-567)
      • engineered (263)
  • Chain 'B':
    Compound: Cytochrome c oxidase subunit 2
    Species: Thermus thermophilus [TaxId:300852]
    Gene: cbaB, ctaC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2qpdb1, d2qpdb2
  • Chain 'C':
    Compound: Cytochrome c oxidase polypeptide 2A
    Species: Thermus thermophilus [TaxId:300852]
    Gene: cbaD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2qpdc1
  • Heterogens: CU1, HEM, HAS, CUA

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2qpdB (B:)
mvdehkahkailayekgwlafslamlfvfialiaytlathtagvipagklervdpttvrq
egpwadpaqavvqtgpnqytvyvlafafgyqpnpievpqgaeivfkitspdvihgfhveg
tninvevlpgevstvrytfkrpgeyriicnqycglghqnmfgtivvke

    Sequence, based on observed residues (ATOM records): (download) 
    >2qpdB (B:)
dehkahkailayekgwlafslamlfvfialiaytlathtagvipagklervdpttvrqeg
pwadpaqavvqtgpnqytvyvlafafgyqpnpievpqgaeivfkitspdvihgfhvegtn
invevlpgevstvrytfkrpgeyriicnqycglghqnmfgtivvke

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >2qpdC (C:)
meekpkgalavilvltltilvfwlgvyavffarg

    Sequence, based on observed residues (ATOM records): (download) 
    >2qpdC (C:)
eekpkgalavilvltltilvfwlgvyavffarg