PDB entry 2qpd
View 2qpd on RCSB PDB site
Description: An unexpected outcome of surface-engineering an integral membrane protein: Improved crystallization of cytochrome ba3 oxidase from Thermus thermophilus
Class: oxidoreductase
Keywords: cytochrome ba3 oxidase, heme,integral membrane protein, Electron transport, Hydrogen ion transport, Ion transport, Iron, Metal-binding, Oxidoreductase, Respiratory chain, Transmembrane, Transport, Formylation
Deposited on
2007-07-23, released
2007-12-11
The last revision prior to the SCOPe 2.04 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 3.25 Å
R-factor: 0.22
AEROSPACI score: 0.13
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Cytochrome c oxidase subunit 1
Species: Thermus thermophilus [TaxId:300852]
Gene: cbaA
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: Cytochrome c oxidase subunit 2
Species: Thermus thermophilus [TaxId:300852]
Gene: cbaB, ctaC
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d2qpdb1, d2qpdb2 - Chain 'C':
Compound: Cytochrome c oxidase polypeptide 2A
Species: Thermus thermophilus [TaxId:300852]
Gene: cbaD
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d2qpdc1 - Heterogens: CU1, HEM, HAS, CUA
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
Sequence, based on SEQRES records: (download)
>2qpdB (B:)
mvdehkahkailayekgwlafslamlfvfialiaytlathtagvipagklervdpttvrq
egpwadpaqavvqtgpnqytvyvlafafgyqpnpievpqgaeivfkitspdvihgfhveg
tninvevlpgevstvrytfkrpgeyriicnqycglghqnmfgtivvke
Sequence, based on observed residues (ATOM records): (download)
>2qpdB (B:)
dehkahkailayekgwlafslamlfvfialiaytlathtagvipagklervdpttvrqeg
pwadpaqavvqtgpnqytvyvlafafgyqpnpievpqgaeivfkitspdvihgfhvegtn
invevlpgevstvrytfkrpgeyriicnqycglghqnmfgtivvke
- Chain 'C':
Sequence, based on SEQRES records: (download)
>2qpdC (C:)
meekpkgalavilvltltilvfwlgvyavffarg
Sequence, based on observed residues (ATOM records): (download)
>2qpdC (C:)
eekpkgalavilvltltilvfwlgvyavffarg