PDB entry 2qor

View 2qor on RCSB PDB site
Description: Crystal structure of Plasmodium vivax guanylate kinase
Class: transferase
Keywords: phosphotransferase, purine metabolism, Structural Genomics, Structural Genomics of Pathogenic Protozoa Consortium, SGPP, PSI, Protein Structure Initiative, Kinase, TRANSFERASE
Deposited on 2007-07-20, released 2007-08-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.201
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Guanylate kinase
    Species: Plasmodium vivax [TaxId:5855]
    Gene: Pv099895, PVX_099895
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2qora_
  • Heterogens: 5GP, POP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qorA (A:)
    mahhhhhhmaripplvvcgpsgvgkgtlikkvlsefpsrfrfsiscttrnkreketngvd
    yyfvdkddferklkegqflefdkyannfygtlkseydlavgegkiclfemningvkqlke
    skhiqdgiyifvkppsidillgrlknrntekpeeinkrmqeltremdeadkvgfnyfivn
    ddlartyaelreyllgsypqlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qorA (A:)
    maripplvvcgpsgvgkgtlikkvlsefpsrfrfsiscttrnkreketngvdyyfvdkdd
    ferklkegqflefdkyannfygtlkseydlavgegkiclfemningvkqlkeskhiqdgi
    yifvkppsidillgrlknrntekpeeinkrmqeltremdeadkvgfnyfivnddlartya
    elreyllgsypqlrgg