PDB entry 2qo5

View 2qo5 on RCSB PDB site
Description: Crystal structure of the cysteine 91 threonine mutant of zebrafish liver bile acid-binding protein complexed with cholic acid
Class: Lipid Binding Protein
Keywords: liver bile acid-binding protein, BABP, fatty acid-binding protein, FABP, liver (basic) fatty acid-binding protein, cholic acid, cholate, bile acid, C91T mutant, Lipid-binding, Transport, Lipid Binding Protein
Deposited on 2007-07-20, released 2007-07-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.22
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Liver-basic fatty acid binding protein
    Species: Danio rerio [TaxId:7955]
    Gene: fabp10
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I8L5 (1-125)
      • expression tag (0)
      • engineered (91)
      • expression tag (126-128)
    Domains in SCOPe 2.08: d2qo5a1, d2qo5a2, d2qo5a3
  • Heterogens: CHD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qo5A (A:)
    safsgtwqvyaqenyeeflraislpeeviklakdvkpvteiqqngsdftitsktpgktvt
    nsftigkeaeittmdgkklkcivkldggklvtrtdrfshiqeikagemvetltvggttmi
    rkskkilvp