PDB entry 2qo4

View 2qo4 on RCSB PDB site
Description: Crystal structure of zebrafish liver bile acid-binding protein complexed with cholic acid
Class: Lipid Binding Protein
Keywords: liver bile acid-binding protein, BABP, fatty acid-binding protein, FABP, liver (basic) fatty acid-binding protein, cholic acid, cholate, bile acid, Lipid-binding, Transport, Lipid Binding Protein
Deposited on 2007-07-20, released 2007-07-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.188
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Liver-basic fatty acid binding protein
  Species: Danio rerio [TaxId:7955]
  Gene: fabp10
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9I8L5 (Start-125)
  Domains in SCOPe 2.08: d2qo4a_
• Heterogens: CHD, IPA, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2qo4A (A:)
  mafsgtwqvyaqenyeeflraislpeeviklakdvkpvteiqqngsdftitsktpgktvt
  nsftigkeaeittmdgkklkcivkldggklvcrtdrfshiqeikagemvetltvggttmi
  rkskki
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2qo4A (A:)
  afsgtwqvyaqenyeeflraislpeeviklakdvkpvteiqqngsdftitsktpgktvtn
  sftigkeaeittmdgkklkcivkldggklvcrtdrfshiqeikagemvetltvggttmir
  kskki