PDB entry 2qn0

View 2qn0 on RCSB PDB site
Description: Structure of Botulinum neurotoxin serotype C1 light chain protease
Class: toxin
Keywords: botulism, SNAREs, protease, neurotoxin
Deposited on 2007-07-17, released 2007-09-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.188
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neurotoxin
    Species: Clostridium botulinum [TaxId:1491]
    Gene: bont/C
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93HT3 (Start-426)
      • expression tag (427-429)
    Domains in SCOPe 2.07: d2qn0a1, d2qn0a2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qn0A (A:)
    mpitinnfnysdpvdnknilyldthlntlanepekafritgniwvipdrfsrnsnpnlnk
    pprvtspksgyydpnylstdsdkdtflkeiiklfkrinsreigeeliyrlstdipfpgnn
    ntpintfdfdvdfnsvdvktrqgnnwvktgsinpsviitgpreniidpetstfkltnntf
    aaqegfgalsiisisprfmltysnatndvgegrfsksefcmdpililmhelnhamhnlyg
    iaipndqtissvtsnifysqynvkleyaeiyafggptidlipksarkyfeekaldyyrsi
    akrlnsittanpssfnkyigeykqklirkyrfvvessgevtvnrnkfvelyneltqifte
    fnyakiynvqnrkiylsnvytpvtanilddnvydiqngfnipksnlnvlfmgqnlsrnpa
    lrkvnpeplv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qn0A (A:)
    pitinnfnysdpvdnknilyldthlntlanepekafritgniwvipdrfsrnsnpnlnkp
    prvtspksgyydpnylstdsdkdtflkeiiklfkrinsreigeeliyrlstdipfpgnnn
    tpintfdfdvdfnsvdvktrqgnnwvktgsinpsviitgpreniidpetstfkltnntfa
    aqegfgalsiisisprfmltysnatndvgegrfsksefcmdpililmhelnhamhnlygi
    aipndqtissvtsnifysqynvkleyaeiyafggptidlipksarkyfeekaldyyrsia
    krlnsittanpssfnkyigeykqklirkyrfvvessgevtvnrnkfvelyneltqiftef
    nyakiynvqnrkiylsnvytpvtanilddnvydiqngfnipksnlnvlfmgqnlsrnpal
    rkvnpeplv