PDB entry 2qmv

View 2qmv on RCSB PDB site
Description: High Resolution Structure of Peroxisone Proliferation-Activated Receptor gamma and Characterisation of its Interaction with the Co-activator Transcriptional Intermediary Factor 2
Class: transcription regulator
Keywords: Peroxisome Profileration Activated Receptor gamma, Pparg, Transcriptional Intermediary Factor 2 (TIF2), Protein Structure, Activator, Diabetes mellitus, Disease mutation, DNA-binding, Metal-binding, Nucleus, Obesity, Phosphorylation, Transcription regulation, Zinc-finger, transcription regulator
Deposited on 2007-07-17, released 2008-09-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2qmva_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qmvA (A:)
    esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
    itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
    ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
    fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
    tehvqllqvikktetdmslhpllqeiykdl