PDB entry 2qmu

View 2qmu on RCSB PDB site
Description: Structure of an archaeal heterotrimeric initiation factor 2 reveals a nucleotide state between the GTP and the GDP states
Class: translation
Keywords: initiation of translation, GTP-binding, Initiation factor, Nucleotide-binding, Protein biosynthesis, RNA-binding, TRANSLATION
Deposited on 2007-07-17, released 2007-11-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.254
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Translation initiation factor 2 gamma subunit
    Species: SULFOLOBUS SOLFATARICUS [TaxId:273057]
    Gene: eif2g
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qmua1, d2qmua2, d2qmua3
  • Chain 'B':
    Compound: Translation initiation factor 2 alpha subunit
    Species: SULFOLOBUS SOLFATARICUS [TaxId:273057]
    Gene: eif2a
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97Z79 (1-92)
      • expression tag (0)
    Domains in SCOPe 2.07: d2qmub1, d2qmub2
  • Chain 'C':
    Compound: Translation initiation factor 2 beta subunit
    Species: SULFOLOBUS SOLFATARICUS [TaxId:273057]
    Gene: eif2b
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, PO4, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qmuA (A:)
    awpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvces
    ckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaan
    epfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpii
    pvsalhkinidsliegieeyiktpyrdlsqkpvmlvirsfdvnkpgtqfnelkggviggs
    iiqglfkvdqeikvlpglrvekqgkvsyepiftkissirfgdeefkeakpgglvaigtyl
    dpsltkadnllgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmlsv
    gssttlgivtsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qmuB (B:)
    mrkvkmsglitvrtneplgvekikeviskalenieqdyesllnikiytigapryrvdvvg
    tnpkeasealnqiisnlikigkeenvdisvvkk
    

  • Chain 'C':
    No sequence available.