PDB entry 2qme

View 2qme on RCSB PDB site
Description: Crystal structure of human RAC3 in complex with CRIB domain of human p21-activated kinase 1 (PAK1)
Class: signaling protein/transferase
Keywords: GTPase RAC3, small GTP binding protein, p21 rac, ras-related C3 botulinum toxin substrate 3, signaling protein, CRIB, kinase, Structural Genomics, Structural Genomics Consortium, SGC, Cell projection, GTP-binding, Lipoprotein, Membrane, Methylation, Nucleotide-binding, Prenylation, Allosteric enzyme, ATP-binding, Phosphorylation, Serine/threonine-protein kinase, Transferase, Apoptosis, Cell junction, SIGNALING PROTEIN-TRANSFERASE COMPLEX
Deposited on 2007-07-16, released 2007-08-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.151
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ras-related c3 botulinum toxin substrate 3
    Species: Homo sapiens [TaxId:9606]
    Gene: RAC3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60763 (1-177)
      • cloning artifact (178)
    Domains in SCOPe 2.05: d2qmea_
  • Chain 'I':
    Compound: CRIB domain of the Serine/threonine-protein kinase PAK 1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, GCP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qmeA (A:)
    smqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdta
    gqedydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcphtpillvgtkldl
    rddkdtierlrdkklapitypqglamareigsvkylecsaltqrglktvfdeairavlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qmeA (A:)
    mqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag
    qedydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcphtpillvgtkldlr
    ddkdtierlrdkklapitypqglamareigsvkylecsaltqrglktvfdeairavlg
    

  • Chain 'I':
    No sequence available.