PDB entry 2qlv

View 2qlv on RCSB PDB site
Description: Crystal structure of the heterotrimer core of the S. cerevisiae AMPK homolog SNF1
Class: Transferase/Protein binding
Keywords: heterotrimer, ATP-binding, Carbohydrate metabolism, Kinase, Membrane, Nucleotide-binding, Nucleus, Phosphorylation, Serine/threonine-protein kinase, Transferase, Lipoprotein, Myristate, CBS domain, Transcription, Transcription regulation, Transferase/Protein binding COMPLEX
Deposited on 2007-07-13, released 2007-09-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.239
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbon catabolite derepressing protein kinase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SNF1, CAT1, CCR1, GLC2, PAS14
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2qlva1
  • Chain 'B':
    Compound: Protein SIP2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SIP2, SPM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2qlvb1, d2qlvb2
  • Chain 'C':
    Compound: Nuclear protein SNF4
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SNF4, CAT3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2qlvc1, d2qlvc2
  • Chain 'D':
    Compound: Carbon catabolite derepressing protein kinase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SNF1, CAT1, CCR1, GLC2, PAS14
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2qlvd_
  • Chain 'E':
    Compound: Protein SIP2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SIP2, SPM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2qlve1, d2qlve2
  • Chain 'F':
    Compound: Nuclear protein SNF4
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SNF4, CAT3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2qlvf1, d2qlvf2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qlvA (A:)
    ykeedstvsilptslpqihranmlaqgspaaskisplvtkksktrwhfgirsrsypldvm
    geiyialknlgaewakpseedlwtiklrwkydignktntnekipdlmkmviqlfqietnn
    ylvdfkfdgwessygddttvsnisedemstfsaypflhlttklimelavns
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qlvA (A:)
    ykeedstvsilptslpqihranmlaqgspaaskisplvttrwhfgirsrsypldvmgeiy
    ialknlgaewakpslwtiklrwkdlmkmviqlfqnnylvdfkfdgwesemstfsaypflh
    lttklimelavns
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2qlvB (B:)
    slmvpveirwqqggskvyvtgsftkwrkmiglipdsdnngsfhvklrllpgthrfrfivd
    nelrvsdflptatdqmgnfvnyievrqpeknptnekirskeadsmrpptsdrssialqig
    kdpddfgdgytrfhedlsprppleyttdipavftdpsvmeryyytldrqqsntdtswltp
    pqlppqlenvilnkyyatqdqfnennsgalpipnhvvlnhlvtssikhntlcvasivryk
    qkyvtqilytpi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qlvB (B:)
    slmvpveirwqqggskvyvtgsftkwrkmiglipdsdnngsfhvklrllpgthrfrfivd
    nelrvsdflptatdqmgnfvnyievrqttdipavftdpsvmeryyytldrppqlppqhvv
    lnhlvtssikhntlcvasivrykqkyvtqilytpi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2qlvC (C:)
    sqekvsieqqlavesirkflnsktsydvlpvsyrlivldtsllvkkslnvllqnsivsap
    lwdsktsrfaglltttdfinviqyyfsnpdkfelvdklqldglkdieralgvdqldtasi
    hpsrplfeaclkmlesrsgriplidqdeethreivvsvltqyrilkfvalncrethflki
    pigdlniitqdnmkscqmttpvidviqmltqgrvssvpiidengylinvyeaydvlglik
    ggiyndlslsvgealmrrsddfegvytctkndklstimdnirkarvhrffvvddvgrlvg
    vltlsdilkyillgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qlvC (C:)
    sqekvsieqqlavesirkflnsktsydvlpvsyrlivldtsllvkkslnvllqnsivsap
    lwdsktsrfaglltttdfinviqyyfsnpdkfelvdklqldglkdieralgvdqldtasi
    hpsrplfeaclkmlesrsgriplidqreivvsvltqyrilkfvalncrethflkipigdl
    niitqdnmkscqmttpvidviqmltqgrvssvpiidengylinvyeaydvlglikggiyn
    dlslsvgealmrrsddfegvytctkndklstimdnirkarvhrffvvddvgrlvgvltls
    dilkyillgs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2qlvD (D:)
    ykeedstvsilptslpqihranmlaqgspaaskisplvtkksktrwhfgirsrsypldvm
    geiyialknlgaewakpseedlwtiklrwkydignktntnekipdlmkmviqlfqietnn
    ylvdfkfdgwessygddttvsnisedemstfsaypflhlttklimelavns
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qlvD (D:)
    ykeedstvsilptslpqihranmlaqgspaaskisplvttrwhfgirsrsypldvmgeiy
    ialknlgaewakpslwtiklrwkdlmkmviqlfqnnylvdfkfdgwesemstfsaypflh
    lttklimelavns
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2qlvE (E:)
    slmvpveirwqqggskvyvtgsftkwrkmiglipdsdnngsfhvklrllpgthrfrfivd
    nelrvsdflptatdqmgnfvnyievrqpeknptnekirskeadsmrpptsdrssialqig
    kdpddfgdgytrfhedlsprppleyttdipavftdpsvmeryyytldrqqsntdtswltp
    pqlppqlenvilnkyyatqdqfnennsgalpipnhvvlnhlvtssikhntlcvasivryk
    qkyvtqilytpi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qlvE (E:)
    slmvpveirwqqggskvyvtgsftkwrkmiglipdsdnngsfhvklrllpgthrfrfivd
    nelrvsdflptatdqmgnfvnyievrqtdipavftppqlppqhvvlnhlvtssikhntlc
    vasivrykqkyvtqilytpi
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2qlvF (F:)
    sqekvsieqqlavesirkflnsktsydvlpvsyrlivldtsllvkkslnvllqnsivsap
    lwdsktsrfaglltttdfinviqyyfsnpdkfelvdklqldglkdieralgvdqldtasi
    hpsrplfeaclkmlesrsgriplidqdeethreivvsvltqyrilkfvalncrethflki
    pigdlniitqdnmkscqmttpvidviqmltqgrvssvpiidengylinvyeaydvlglik
    ggiyndlslsvgealmrrsddfegvytctkndklstimdnirkarvhrffvvddvgrlvg
    vltlsdilkyillgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qlvF (F:)
    sqekvsieqqlavesirkflnsktsydvlpvsyrlivldtsllvkkslnvllqnsivsap
    lwdsktsrfaglltttdfinviqyyfsnpdkfelvdklqldglkdieralgvdqldtasi
    hpsrplfeaclkmlesrsgriplidqreivvsvltqyrilkfvalncrethflkipigdl
    niitqdnmkscqmttpvidviqmltqgrvssvpiidengylinvyeaydvlglikggiyn
    dlslsvgealmrrsddfegvytctkndklstimdnirkarvhrffvvddvgrlvgvltls
    dilkyillgs