PDB entry 2qlq

View 2qlq on RCSB PDB site
Description: Crystal structure of SRC kinase domain with covalent inhibitor RL3
Class: transferase
Keywords: Src kinase domain, drug resistance, irreversible inhibitor, kovalent inhibitor, Alternative splicing, ATP-binding, Lipoprotein, Myristate, Nucleotide-binding, Phosphorylation, Proto-oncogene, SH2 domain, SH3 domain, Transferase, Tyrosine-protein kinase
Deposited on 2007-07-13, released 2008-03-11
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-03-03, with a file datestamp of 2009-02-27.
Experiment type: XRAY
Resolution: 2.33 Å
R-factor: 0.215
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00523 (Start-285)
      • engineered (97)
    Domains in SCOPe 2.03: d2qlqa_
  • Chain 'B':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00523 (Start-285)
      • engineered (97)
    Domains in SCOPe 2.03: d2qlqb_
  • Heterogens: SR2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qlqA (A:)
    ghmqtqglakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaf
    lqeaqvmkklrheklvqlyavvseepiyivteymskgclldflkgemgkylrlpqlvdma
    aqiasgmayvermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpik
    wtapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppec
    peslhdlmcqcwrkdpeerptfeylqafledyftstepqyqpgenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qlqA (A:)
    akdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlaqvmkklrheklvqlyav
    vsepiyivteymskgclldflkgemgkylrlpqlvdmaaqiasgmayvermnyvhrdlra
    anilvgenlvckvadfpikwtapeaalygrftiksdvwsfgilltelttkgrvpypgmvn
    revldqvergyrmpcppecpeslhdlmcqcwrkdpeerptfeylqafledyftstepqyq
    pgenl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2qlqB (B:)
    ghmqtqglakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaf
    lqeaqvmkklrheklvqlyavvseepiyivteymskgclldflkgemgkylrlpqlvdma
    aqiasgmayvermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpik
    wtapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppec
    peslhdlmcqcwrkdpeerptfeylqafledyftstepqyqpgenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qlqB (B:)
    kdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlqvmkklrheklvqlyavvs
    eepiyivteymskgclldflkgemgkylrlpqlvdmaaqiasgmayvermnyvhrdlraa
    nilvgenlvckvadfglarpikwtapeaalygrftiksdvwsfgilltelttkgrvpypg
    mvnrevldqvergyrmpcppecpeslhdlmcqcwrkdpeerptfeylqafledyftstep
    qyqpgenl