PDB entry 2ql0

View 2ql0 on RCSB PDB site
Description: Zinc-substituted Rubredoxin from Desulfovibrio Vulgaris
Class: electron transport
Keywords: [Fe-4S], Electron Transport, Iron, Metal-binding
Deposited on 2007-07-12, released 2008-07-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: rubredoxin
  Species: Desulfovibrio vulgaris
  Gene: rub
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00269 (0-51)
  Domains in SCOPe 2.07: d2ql0a_
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ql0A (A:)
  mkkyvctvcgyeydpaegdpdngvkpgtsfddlpadwvcpvcgapksefeaa