PDB entry 2qil

View 2qil on RCSB PDB site
Description:
Deposited on 1997-03-27, released 1997-08-12
The last revision prior to the SCOP 1.55 freeze date was dated 1997-08-12, with a file datestamp of 1997-08-13.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: 0.204
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d2qila1, d2qila2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d2qilb1, d2qilb2
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d2qilc1, d2qilc2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qilA (A:)
    stndnikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkge
    kvdlntkrtkksqhtsegtyihfqisgvtnteklptpielplkvkvhgkdsplkywpkfd
    kkqlaistldfeirhqltqihglyrssdktggywkitmndgstyqsdlskkfeyntekpp
    inideiktieaein
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qilB (B:)
    stndnikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkge
    kvdlntkrtkksqhtsegtyihfqisgvtnteklptpielplkvkvhgkdsplkywpkfd
    kkqlaistldfeirhqltqihglyrssdktggywkitmndgstyqsdlskkfeyntekpp
    inideiktieaein
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qilC (C:)
    stndnikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkge
    kvdlntkrtkksqhtsegtyihfqisgvtnteklptpielplkvkvhgkdsplkywpkfd
    kkqlaistldfeirhqltqihglyrssdktggywkitmndgstyqsdlskkfeyntekpp
    inideiktieaein