PDB entry 2qi8

View 2qi8 on RCSB PDB site
Description: Crystal structure of drug resistant SRC kinase domain
Class: signaling protein, transferase
Keywords: Src kinase domain; drug resistance, SIGNALING PROTEIN, TRANSFERASE
Deposited on 2007-07-03, released 2008-03-18
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.32 Å
R-factor: 0.209
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00523 (Start-285)
      • engineered (90)
      • engineered (97)
    Domains in SCOPe 2.03: d2qi8a_
  • Chain 'B':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00523 (Start-285)
      • engineered (90)
      • engineered (97)
    Domains in SCOPe 2.03: d2qi8b_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qi8A (A:)
    ghmqtqglakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaf
    lqeaqvmkklrheklvqlyavvseepiyivmeymskgclldflkgemgkylrlpqlvdma
    aqiasgmayvermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpik
    wtapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppec
    peslhdlmcqcwrkdpeerptfeylqafledyftstepqyqpgenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qi8A (A:)
    kdaweipreslrlevklgqgcfgevwmgtwngttrvaiktleaflqeaqvmkklrheklv
    qlyavvsepiyivmeymskgclldflkgemgkylrlpqlvdmaaqiasgmayvermnyvh
    rdlraanilvgenlvckvadfglarlpikwtapeaalygrftiksdvwsfgilltelttk
    grvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkdpeerptfeylqafled
    yftstepqyqpgenl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2qi8B (B:)
    ghmqtqglakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaf
    lqeaqvmkklrheklvqlyavvseepiyivmeymskgclldflkgemgkylrlpqlvdma
    aqiasgmayvermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpik
    wtapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppec
    peslhdlmcqcwrkdpeerptfeylqafledyftstepqyqpgenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qi8B (B:)
    daweipreslrlevklgqgevwmgtwngttrvaiktlaflqeaqvmkklrheklvqlyav
    vseepiyivmeymskgclldflkgemgkylrlpqlvdmaaqiasgmayvermnyvhrdlr
    aanilvgenlvckvadfglapikwtapeaalygrftiksdvwsfgilltelttkgrvpyp
    gmvnrevldqvergyrmpcppecpeslhdlmcqcwrkdpeerptfeylqafledyftste
    pqyqpgenl