PDB entry 2qfk

View 2qfk on RCSB PDB site
Description: X-ray Crystal Structure Analysis of the Binding Site in the Ferric and Oxyferrous Forms of the Recombinant Heme Dehaloperoxidase Cloned from Amphitrite ornata
Class: transport protein
Keywords: crystal structure of dehaloperoxidase, DHP, globin, heme protein, TRANSPORT PROTEIN
Deposited on 2007-06-27, released 2008-07-08
The last revision prior to the SCOP 1.75 freeze date was dated 2008-07-08, with a file datestamp of 2008-07-03.
Experiment type: XRAY
Resolution: 1.62 Å
R-factor: 0.194
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dehaloperoxidase A
    Species: Amphitrite ornata
    Gene: dhpA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2qfka1
  • Chain 'B':
    Compound: Dehaloperoxidase A
    Species: Amphitrite ornata
    Gene: dhpA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2qfkb1
  • Heterogens: NH4, SO4, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qfkA (A:)
    gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
    nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
    drfgknlvsalssagmk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qfkB (B:)
    gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
    nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
    drfgknlvsalssagmk