PDB entry 2qf6

View 2qf6 on RCSB PDB site
Description: HSP90 complexed with A56322
Class: chaperone
Keywords: Protein-inhibitor Complex, CHAPERONE
Deposited on 2007-06-26, released 2008-07-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.29
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heat shock protein HSP 90-alpha
    Species: HOMO SAPIENS
    Gene: HSP90AA1, HSP90A, HSPC1, HSPCA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07900 (0-206)
      • conflict (46)
    Domains in SCOPe 2.07: d2qf6a_
  • Chain 'B':
    Compound: Heat shock protein HSP 90-alpha
    Species: HOMO SAPIENS
    Gene: HSP90AA1, HSP90A, HSPC1, HSPCA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07900 (0-206)
      • conflict (46)
    Domains in SCOPe 2.07: d2qf6b_
  • Chain 'C':
    Compound: Heat shock protein HSP 90-alpha
    Species: HOMO SAPIENS
    Gene: HSP90AA1, HSP90A, HSPC1, HSPCA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07900 (0-206)
      • conflict (46)
    Domains in SCOPe 2.07: d2qf6c_
  • Chain 'D':
    Compound: Heat shock protein HSP 90-alpha
    Species: HOMO SAPIENS
    Gene: HSP90AA1, HSP90A, HSPC1, HSPCA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07900 (0-206)
      • conflict (46)
    Domains in SCOPe 2.07: d2qf6d_
  • Heterogens: A56, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qf6A (A:)
    vetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryetltdpskldsgkel
    hinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfgv
    gfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqte
    yleerrikeivkkhsqfigypitlfve
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qf6B (B:)
    vetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryetltdpskldsgkel
    hinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfgv
    gfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqte
    yleerrikeivkkhsqfigypitlfve
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qf6C (C:)
    vetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryetltdpskldsgkel
    hinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfgv
    gfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqte
    yleerrikeivkkhsqfigypitlfve
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qf6D (D:)
    vetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryetltdpskldsgkel
    hinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfgv
    gfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqte
    yleerrikeivkkhsqfigypitlfve