PDB entry 2qes

View 2qes on RCSB PDB site
Description: Crystal structure of the ribosome inactivating protein PDL4 from P. dioica leaves in complex with adenine
Class: Hydrolase
Keywords: crystal, ribosome inactivating protein, Hydrolase
Deposited on 2007-06-26, released 2008-02-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.24 Å
R-factor: 0.116
AEROSPACI score: 0.84 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribosome-inactivating protein PD-L4
    Species: Phytolacca dioica [TaxId:29725]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2qesa_
  • Heterogens: ADE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2qesA (A:)
vntitfdvgnatinkyatfmeslrneakdptlkcygipmlpdsnltpkyvlvklqdassk
titlmlrrnnlyvmgysdlyngkcryhifndisstestdventlcpnsnsrekkainyns
qystlqnkagvssrsqvqlgiqilnsdigkisgvstftdkteaefllvaiqmvseaarfk
yienqvktnfnrafnpnpkvlsleenwgkislaihnakngaltsplelknaddtkwivlr
vdeikpdmgllnyvsgtcqtt