PDB entry 2qej

View 2qej on RCSB PDB site
Description: Crystal structure of a Staphylococcus aureus protein (SSL7) in complex with Fc of human IgA1
Class: immune system
Keywords: iga1, antibody, immunoglobulin, ob-fold, beta-grasp, ssl, immune system
Deposited on 2007-06-26, released 2007-09-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.229
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ig alpha-1 c region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01876 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.06: d2qeja1, d2qeja2, d2qeja3
  • Chain 'B':
    Compound: ig alpha-1 c region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2qejb1, d2qejb2
  • Chain 'C':
    Compound: superantigen-like molecule 7
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: ssl7
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: superantigen-like molecule 7
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: ssl7
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qejA (A:)
    eschprlslhrpaledlllgseanltctltglrdasgvtftwtpssgksavqgpperdlc
    gcysvssvlpgcaepwnhgktftctaaypesktpltatlsksgntfrpevhllpppseel
    alnelvtltclargfspkdvlvrwlqgsqelprekyltwasrqepsqgtttfavtsilrv
    aaedwkkgdtfscmvghealplaftqktidrlagkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qejA (A:)
    eschprlslhrpaledlllgseanltctltglrdasgvtftwtpssgksavqgpperdlc
    gcysvssvlpgcaepwnhgktftctaaypesktpltatlsksgntfrpevhllpppseel
    alnelvtltclargfspkdvlvrwlqgsqelprekyltwasrqepsqgtttfavtsilrv
    aaedwkkgdtfscmvghealplaftqktidr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2qejB (B:)
    eschprlslhrpaledlllgseanltctltglrdasgvtftwtpssgksavqgpperdlc
    gcysvssvlpgcaepwnhgktftctaaypesktpltatlsksgntfrpevhllpppseel
    alnelvtltclargfspkdvlvrwlqgsqelprekyltwasrqepsqgtttfavtsilrv
    aaedwkkgdtfscmvghealplaftqktidrlagkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qejB (B:)
    chprlslhrpaledlllgseanltctltglrdasgvtftwtpssgksavqgpperdlcgc
    ysvssvlpgcaepwnhgktftctaaypesktpltatlsksgntfrpevhllpppseelal
    nelvtltclargfspkdvlvrwlqgsqelprekyltwasrqepsqgtttfavtsilrvaa
    edwkkgdtfscmvghealplaftqktidr
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.