PDB entry 2qe3

View 2qe3 on RCSB PDB site
Description: Crystal structure of human tl1a extracellular domain
Class: cytokine
Keywords: tl1a, tnfsf, cytokine;, cytokine
Deposited on 2007-06-22, released 2007-07-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.211
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TNF superfamily ligand TL1A
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFSF15
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2qe3a_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qe3A (A:)
    gshmlkgqefapshqqvyaplradgdkprahltvvrqtptqhfknqfpalhwehelglaf
    tknrmnytnkfllipesgdyfiysqvtfrgmtsecseirqagrpnkpdsitvvitkvtds
    ypeptqllmgtksvcevgsnwfqpiylgamfslqegdklmvnvsdislvdytkedktffg
    afll
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qe3A (A:)
    adgdkprahltvvrqtpfpalhwehelglaftknrmnytnkfllipesgdyfiysqvtfr
    gkpdsitvvitkvtdsypeptqllmgtksvcevgsnwfqpiylgamfslqegdklmvnvs
    dislvdytkedktffgafll