PDB entry 2qdd

View 2qdd on RCSB PDB site
Description: Crystal structure of a member of enolase superfamily from Roseovarius nubinhibens ISM
Class: structural genomics, unknown function
Keywords: ENOLASE, RACEMASE, STRUCTURAL GENOMICS, PSI, PROTEIN STRUCTURE INITIATIVE, NYSGRC, NEW YORK STRUCTURAL GENOMICS RESEARCH CONSORTIUM, New York SGX Research Center for Structural Genomics, NYSGXRC, UNKNOWN FUNCTION
Deposited on 2007-06-20, released 2007-06-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.184
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: Roseovarius nubinhibens [TaxId:89187]
    Gene: COG4948, ISM_14065
    Database cross-references and differences (RAF-indexed):
    • Uniprot A3SNF7 (3-369)
      • cloning artifact (1-2)
      • cloning artifact (370)
    Domains in SCOPe 2.06: d2qdda1, d2qdda2, d2qdda3, d2qdda4
  • Chain 'B':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: Roseovarius nubinhibens [TaxId:89187]
    Gene: COG4948, ISM_14065
    Database cross-references and differences (RAF-indexed):
    • Uniprot A3SNF7 (3-369)
      • cloning artifact (1-2)
      • cloning artifact (370-377)
    Domains in SCOPe 2.06: d2qddb1, d2qddb2, d2qddb3, d2qddb4
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qddA (A:)
    mslritrltvfhldlplakpywlsggrlkfdrldstylridtdegvtgwgegcpwghsyl
    pahgpglragiatlaphllgldprsldhvnrvmdlqlpghsyvkspidmacwdilgqvag
    lplwqllggeaatpvpinssistgtpdqmlgliaeaaaqgyrthsakiggsdpaqdiari
    eaisaglpdghrvtfdvnrawtpaiavevlnsvrardwieqpcqtldqcahvarrvanpi
    mldeclhefsdhlaawsrgacegvkikpnrvggltrarqirdfgvsvgwqmhiedvggta
    ladtaalhlaastpeanrlaswlghahladdpipgqgarnrdglatppsapglgvipdpe
    algrpvasydeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qddA (A:)
    slritrltvfhldlplakpywlsglkfdrldstylridtdegvtgwgegcpwghsylpah
    gpglragiatlaphllgldprsldhvnrvmdlqlpghsyvkspidmacwdilgqvaglpl
    wqllggeaatpvpinssistgtpdqmlgliaeaaaqgyrthsakiggsdpaqdiarieai
    saglpdghrvtfdvnrawtpaiavevlnsvrardwieqpcqtldqcahvarrvanpimld
    eclhefsdhlaawsrgacegvkikpnrvggltrarqirdfgvsvgwqmhiedvggtalad
    taalhlaastpeanrlaswlghahladdpipgqgarnrdglatppsapglgvipdpealg
    rpvasyde
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2qddB (B:)
    mslritrltvfhldlplakpywlsggrlkfdrldstylridtdegvtgwgegcpwghsyl
    pahgpglragiatlaphllgldprsldhvnrvmdlqlpghsyvkspidmacwdilgqvag
    lplwqllggeaatpvpinssistgtpdqmlgliaeaaaqgyrthsakiggsdpaqdiari
    eaisaglpdghrvtfdvnrawtpaiavevlnsvrardwieqpcqtldqcahvarrvanpi
    mldeclhefsdhlaawsrgacegvkikpnrvggltrarqirdfgvsvgwqmhiedvggta
    ladtaalhlaastpeanrlaswlghahladdpipgqgarnrdglatppsapglgvipdpe
    algrpvasydeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qddB (B:)
    slritrltvfhldlplakpfdrldstylridtdegvtgwgegcpwghsylpahgpglrag
    iatlaphllgldprsldhvnrvmdlqlpghsyvkspidmacwdilgqvaglplwqllgge
    aatpvpinssistgtpdqmlgliaeaaaqgyrthsakiggsdpaqdiarieaisaglpdg
    hrvtfdvnrawtpaiavevlnsvrardwieqpcqtldqcahvarrvanpimldeclhefs
    dhlaawsrgacegvkikpnrvggltrarqirdfgvsvgwqmhiedvggtaladtaalhla
    astpeanrlaswlghahladdpipgqgarnrdglatppsapglgvipdpealgrpvasyd
    eghhhhhh