PDB entry 2qck

View 2qck on RCSB PDB site
Description: Crystal structure of flavin reductase domain protein (YP_831077.1) from Arthrobacter sp. FB24 at 1.90 A resolution
Class: oxidoreductase
Keywords: YP_831077.1, Flavin reductase domain protein, Flavin reductase like domain, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, OXIDOREDUCTASE
Deposited on 2007-06-19, released 2007-07-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Flavin reductase domain protein
    Species: Arthrobacter sp. [TaxId:290399]
    Gene: YP_831077.1, Arth_1583
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0JVA7 (Start-166)
      • modified residue (15)
      • modified residue (56)
      • modified residue (76)
      • modified residue (123)
    Domains in SCOPe 2.08: d2qcka_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qckA (A:)
    gmtsdnaafegtfkemfrrhaagvaiitvnyngtpygftatsvaslsaqpprftfnmars
    ssswpaiantthigvhmlgldnqeladrfartknrfegdhwelgpyevpilkdvagwlig
    kiqmrlsfennavvvvevvegqvgedgtpllyhsgaysqpvpldyei
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qckA (A:)
    fegtfkemfrrhaagvaiitvnyngtpygftatsvaslsaqpprftfnmarsssswpaia
    ntthigvhmlgldnqeladrfartknrfegdhwelgpyevpilkdvagwligkiqmrlsf
    ennavvvvevvegqvgedgtpllyhsgaysqpvpldyei