PDB entry 2qci

View 2qci on RCSB PDB site
Description: HIV-1 Protease mutant D30N with potent Antiviral inhibitor GRL-98065
Class: hydrolase
Keywords: HIV-1, mutant D30N, protease inhibitor, HYDROLASE
Deposited on 2007-06-19, released 2008-04-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.161
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367
      • engineered (6)
      • engineered (29)
      • engineered (32)
      • engineered (62)
      • engineered (66)
      • engineered (94)
    Domains in SCOPe 2.07: d2qcia_
  • Chain 'B':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367 (0-98)
      • engineered (6)
      • engineered (29)
      • engineered (32)
      • engineered (62)
      • engineered (66)
      • engineered (94)
    Domains in SCOPe 2.07: d2qcib_
  • Heterogens: NA, CL, ACT, 065, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qciA (A:)
    pqitlwkrplvtikiggqlkealldtgadntvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qciB (B:)
    pqitlwkrplvtikiggqlkealldtgadntvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf