PDB entry 2qca

View 2qca on RCSB PDB site
Description: A New Crystal Form of Bovine Pancreatic RNase A in Complex with 2'-Deoxyguanosine-5'-monophosphate
Class: hydrolase
Keywords: Ribonuclease, Protein-Nucleotide Complex, Structural Genomics, PSI-2, Protein Structure Initiative, Center for High-Throughput Structural Biology, CHTSB, HYDROLASE
Deposited on 2007-06-19, released 2007-07-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.33 Å
R-factor: 0.125
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ribonuclease pancreatic
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61823 (0-123)
  Domains in SCOPe 2.06: d2qcaa_
• Heterogens: DGP, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2qcaA (A:)
  ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
  knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
  dasv