PDB entry 2qc6

View 2qc6 on RCSB PDB site
Description: Protein kinase CK2 in complex with DBC
Class: transferase
Keywords: CK2, DBC, kinase inhibitors, coumarins, TRANSFERASE
Deposited on 2007-06-19, released 2008-02-26
The last revision prior to the SCOP 1.75 freeze date was dated 2008-04-15, with a file datestamp of 2008-04-11.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.217
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Casein kinase II subunit alpha
    Species: Zea mays
    Gene: ACK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28523
      • modified residue (83)
    Domains in SCOP 1.75: d2qc6a1
  • Heterogens: G12, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qc6A (A:)
    mskarvyadvnvlrpkeywdyealtvqwgeqddyevvrkvgrgkysevfeginvnnnekc
    iikilkpvkkkkikreikilqnlcggpnivklldivrdqhsktpslifeyvnntdfkvly
    ptltdydiryyiyellkaldychsqgimhrdvkphnvmidhelrklrlidwglaefyhpg
    keynvrvasryfkgpellvdlqdydysldmwslgcmfagmifrkepffyghdnhdqlvki
    akvlgtdglnvylnkyrieldpqlealvgrhsrkpwlkfmnadnqhlvspeaidfldkll
    rydhqerltaleamthpyfqqvraaensrtra
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qc6A (A:)
    skarvyadvnvlrpkeywdyealtvqwgeqddyevvrkvgrgkysevfeginvnnnekci
    ikilkpvkkkkikreikilqnlcggpnivklldivrdqhsktpslifeyvnntdfkvlyp
    tltdydiryyiyellkaldychsqgimhrdvkphnvmidhelrklrlidwglaefyhpgk
    eynvrvasryfkgpellvdlqdydysldmwslgcmfagmifrkepffyghdnhdqlvkia
    kvlgtdglnvylnkyrieldpqlealvgrhsrkpwlkfmnadnqhlvspeaidfldkllr
    ydhqerltaleamthpyfqqvraaens