PDB entry 2qbr

View 2qbr on RCSB PDB site
Description: Crystal structure of ptp1b-inhibitor complex
Class: hydrolase
Keywords: protein-inhibitor complex, hydrolase
Deposited on 2007-06-18, released 2008-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.2
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosine-protein phosphatase non-receptor type 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN1, PTP1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2qbra_
  • Heterogens: 910, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qbrA (A:)
    memekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklh
    qedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslk
    caqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwp
    dfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkd
    pssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshedl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qbrA (A:)
    emekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhq
    edndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkc
    aqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpd
    fgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdp
    ssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshedl