PDB entry 2qak

View 2qak on RCSB PDB site
Description: HIV-1 PR mutant in complex with nelfinavir
Class: hydrolase
Keywords: HIV protease inhibitors; protease-inhibitor structure; isothermal calorimetry; antiviral resistance development, HYDROLASE
Deposited on 2007-06-16, released 2008-07-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-20.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.205
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protease retropepsin
  Species: human immunodeficiency virus 1
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03367 (0-98)
    • engineered (29)
    • engineered (54)
    • engineered (89)
  Domains in SCOPe 2.08: d2qaka_
• Chain 'B':
  Compound: protease retropepsin
  Species: human immunodeficiency virus 1
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03367 (0-98)
    • engineered (29)
    • engineered (54)
    • engineered (89)
  Domains in SCOPe 2.08: d2qakb_
• Heterogens: 1UN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2qakA (A:)
  pqitlwqrplvtikiggqlkealldtgadntvleemslpgrwkpkmiggiggfiavrqyd
  qilieicghkaigtvlvgptpvniigrnlmtqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2qakB (B:)
  pqitlwqrplvtikiggqlkealldtgadntvleemslpgrwkpkmiggiggfiavrqyd
  qilieicghkaigtvlvgptpvniigrnlmtqigctlnf